Z$``@0 C0T7QT" 3 R @$( U|R I``` ```@``ﾭ (OР iHMP  H4P OР iHM  H4P OР iHM! H4P HOР iHMp! H4P OР iHM! H4P OР iHM0" H4P hOР iHM" H4P ])/@- ztР@<РA<sFHРP L8((0 S,EE 8 _dHepa8/*/0Od@P TP  Q:< 80QR:/}- $M<0 @DH 0! 0 0 uI$Ѝ/s@-0`40P@0P  dPlL`0T\\F x xr0S  008 T6/Ѝpy d db dwd d//p@-P R PZ Q0A800P0P  10  ` R R P! 0 0 100 0< @0D H  Q R ````0 B 10` 000 p@Q R $3d ddAT ATATBTp@-`` @P xp  =n@-@P (VPڠP `[@ d d0/0+0RA-@P`p`R h B(0H@ RAA AA / RS̴ P/@- R39C R- 0l@*H@ R ` R<\|Q RQ`r l 0@P`p 0@P`p*/0@$$0@$$@/l\0@Ѥ0@ R \3 e R$ l@ B0!:-` R<\|.4 RS<$DL%T\&dl't|( ) ,Ġ̌`r .4\<0RA R$ l@ B0!:-` R<\|.8 RS8$HH%XX&hh'xx( ) ,ȠȌ`r .8\80RA R$ l@ B0!:-` R<\|.< RS4$LD%\T&ld'|t( ) ,̠Č`r .<\40RAL/@-0<44,D$H@* d d d d# dH D H  BH /4 9 uD0 00/@`//@-ZA dp@-M@x 8 <d@Pb  L8L <0 @C4,00 4$ 0$ (000 00 0 VNnZ z C0c0vV`@0 @01 0zx 40 27HP L@@0S dd3ddd$dOdSdddddddwddjdydd dd#d+d_ddadd$aP; @[8 0S@DV@@G00 JP (ЍMeJQ <@P0S <8P p @ FIP p(t (Ѝgfff(`TdgdtddA-Pp @`0 0U 0p`0 2 P*bP  H[P 0 /70P 0C0wdp@-P`3@P0pV00Cpd@-@M@@ \ @ 0#,,#4 <0Co@Ѝ@- 0@#$(#4, 8@0#,,#4 <0Co<0 R/A-`P@P@ .<Ġ< . 00<P0Q`P&<t )X\tHPt ~  z v0@( 0 mU2"TP TX (P6V@TP@ PzTЍl P TP L< P 2TP   P@=TP  νP   0@p 0 U 0 TP 8ߎd*,d-Rd+dZ,d"d+d+d+d{Ad+d ,do,du,d,d@- 0 @GЍdp@-M`@PP#V 00-SRPЍp0@@ `0h `4pThPP 86PP0Shh@,d,dA-`0BSpP@T FP 0 DRU(0^0pA/dTaR@-Eg@ @{I-d0 S-d@-  Ѝc-d@-@8gM@P`U pP< 0@ |0U` @0pSPPH@<48,L$ V@P0   v@T%崇lptl R l Ϸ뒯~gߍtx `rt-d-d-d-d-d-d-d-d-d-d-d-d-dd .d.dd=.dO.dX.d`.di.d.d1.dRA-@PD`B pFP 0 A//DdR p@-@ P@W *p/.d-$M W00 00$Ѝ.dM-E눠刀P@?@TH0h`  XX0@D0PpHD 0 R400Vp@dwd/dQe/d(dd/d Qe 0 B0 S 000C P 2#0//@-@.Pp'W` 0@0FS`FP00 P Ѝp V5P  P 0d2#0P` V`PV0  S 0P0S0PP0;S0 V 0< ?bcP0d 6#`VQ0@-{P w>{P{@P j>T{PWP [>@{P l X,(PPP $  0, ;0d$'dT0db0d|d0d0d0dc20d0dRA-`Pp)@P@`U` ?>`>UT 6>1ds@-PBU`:@-Q@sQpQ-PR`  ;pPE`000qP@ T 0pSO@P P岿=03/@P0@Ѝp@@"0dB2dj2dR2@-PՄM`@VP 建PP `ႿX=T囅PHzЍ`,叅@PK 勅@Pk  j@偅 Rb C@x P ;pp@PU k ,4,8   '@\ P p@hT P X@PL P @@8DpP. @|P ! 32tP!3 P gPK="5/3=ܾKp =0d2d2d2d2d3d3d!dV3d_3ddv3dd{3dd3dd3d3d3d3d3d3dMd03dh3dd3dR  @- ` ` /@-ŋ Ѝ@-׋ Ѝ@-t Ѝ@-ˋ Ѝ@-h Ѝ@-始 Ѝ@-幋 Ѝ@-V ЍRp@-`Ml剾`Ѝp@00  0JPP  `呔P 0 r<7d8d0QS-p Q  Q0 S 00S0\0S /^dM-P@`Pp 㩾pT% `P Df<@q`TM(_<V[<Y<``{P%T MT00CAḀ帠pD`VM1V#$(#4<| `T\DpDTL0DV<  `;d;d;d;d;ddwdCd;d;d1_d;d@-@ӽ0@ @Ӄ;dHd;dRM-HM@<p P@PhpGP`Wz 0-S V':*Pt Z&%cS qS`0SPpG$*P^ Z  ƃ 函HЍPMZ  l W 0#,Ġ, #4 < P *Vxh?\h }`&P``V 30T( ㊸P=W峽n)P ᪽W@0 "<<"$0,0 MP  (叽 ,, ,0 ,Ġ Q*8 8@n0S ;; ?PW9 @Pզ  P̦  $@PW PW@l 0|  RH Q 8 0000 <RpG600<P>QN W Q@!   0 0?R    ,,   0    BR` j    Q [R0(100[ ; ]R  R R@!   D0]Q00 : PS@ 7ʼ :  W 0宷@PP 0  W  0gS0W0vW0sSp  Q @P3n[ s[W4x p0nS@〼P0 RS PnR U fA 0̡ 0@P0sS0ᒤ`P[ @TX0vSLT Wp  1@TpPcP%T0 P%W T1#,,#4 <  ➻W PpGP `UvPTwڬ0 ၻPTaS sSᖁ}iT`l@C@lS W4 W @@ ᚤPP}T0 0 PP iVUPbQ [H ᷢX P& x6Q ppAH@TP ■0@SOx` `T` `4`4`4`4``=@DXA)T tP <0P#$(#4<!<< !0PwXLXAX0@AQ $AX PPW rPԧP0hSW00gSld@P @ T1 #$(#4<0#L$L(#4@<@0#$(#4<ᕺ00#,,#4<  ሺ00#$(#4<|0l 0#$(#4<p0@0#$(#4<da0 0#$(#4<UT'00#$(#4<GT 0 0#$(#4<9T 0p$0#$(#4<+i<&4 ]PWW出 <$<( 0 00 H@PWB 建 p ᵺ 0%Op /P00pSc,\qPXTX0 @P$0000 0й\d;d;d;dddd`>dZodd5>dQ>dW>d^>d[>df>ds>dd>d>d c>d>d>d>d?d&?d4?dK?db?dy?d?d?dװd1d@d?d?d?d1@dO@dDdCdHdaS : p@4 0gPeRpIdS ٹ坥PWD; 㜴P@G@WP@ 役PPEl$ #7 〴P|W 媹{%)Z 0l0T10S0@2bdR7@-@P  `PS79TVPVP P Ѝ09UP (9 0 Ѝ0@ AdAdAd9AdLdRaRM-phMP`EYU@ 0 DPP0 @00 0 00ָ0 ?K P  ̸hЍP)P$  ,, 48 ,,Ġ ? 0 @ K P00@46/Bd Cd?Cd#Cd0d@- @*RT T T TA00*Sٸ$S/0{S  /S 0}S00y~M-Pp`ᰳlAh ኳPK女XGVP! @nU? ``H`$`4`D`oPPP @Uꐜ````Ĝ`̜`DoTTTTT@ TcVCdR@-@>P0Pp0 46P o/mCd0 0 0 /dpdxd,0 (0 $0 0 0 0 /ldhdd|dxdtd,0 (0 $0 0 0 0 /hdld|ddtdxd@-C6P @5p@-AM` @@PP@ A`厷Aލp@P  A P\P A AA Aq kn}DdD` Ddd 00S/ 0/dxd$ 0S<#?/d80p@-4P@T(@Pp55@DdddM-KMl F⒮pС`P㪏ı@[^ P5 R q5 PT QP] P[ | p!Q 5P QPP @0 @F➭ P   >@P0SpdjQ.=5 FC0U0C0P!V`1@@DA0 |@Ӷh| P HR0 t>PKލdua4Dd'dDddp@-@P|0P1@oU@ -@l坶bd@P65P 4@Tu0卶p 制0PpDddDdDdEd0dM-$`@|PU ߶PV ضVPԶpP pZ ^IJ4pg忲4 P偱`P  tKpPX6X`A@Z @;$塲}4g圲\4PЍ[ @P %pPe5@5%P5 5% 5 5# 55 5*4005% $4P P@4`b 4_ @ 0D 00S0+* 4S `@ `F0S@`C4F 3`B 3? ` @@,"/? 0 S4 K `F `_ k&@t0030" DX@`F= R1 $`@Q  0?S@2/00V3 <#O?@ @P3 P) 00#000@ 00N00@(t3@00 -x`30S0 8303/SX<0 8R010 0SX b p00Ÿ02#0 S0C0Ÿ0 0CS@I~S@D !S@? l @S @5 `@\ ?\@,ŸS@@& ŸS@ @- S# @  NS @  1S @ S @  "0 0 00@~00000 00Y00 @0 0q00#00@Y00 @00@ BX1@00@Dd`q3P 26`VTl0  徴zu ᶴ0@Pq!d4EdPfEdlEd0dEdFdEdEdFd:Fdpd`ddT`ddddldPdTddhdgdxdyFd DddEdRM-,`0尰尠@0Pp 0;@P p X P ݴp0 0PPp@ЍddddR@-$@㿴 Pd3HdR@-0 B0 0 7 ЍJHdA-`0BS,p឴P嚴W@ 㔴Pt%p塰``T``T HM`፰ ꊰꇰPHdﾭyHdR>p@-`;PP9d@`P U0U0U00U0 R  BU0 R  BU0 R  B0S  /pRE-@M4`:@P<0DS qpܠ0P0 ` HP @ T0S PBP @l0P勳@X ᆳЍT T00 `@cHddHdHdM-@Pp `m:PP+ ʳ10@|YU`EdS`\0PW @P< -RW `e  R@`ЍUW@,UW@#`UW@|`W \`UP @0`U,$dddHdHdIdLeIdIdIdR }/R v/A-p0BS,9PP(C0 @ ㇳX` 50P:U``r U @` UP`*dR M-@9`P\PPp  P,0 /dId7@-P@0 -R Ѝ0p@-P @Q(l0 Up@e c;LdJLdBLdRM-XME@`7P 0=0P7`060D7< 0708708007090(703 7p0<0嗭P0ӅU= 7 6U 9 8U 㒲U8#80700S <TP t XЍy8<0iS4U6@`,v,`@TZ;00:0@ P@ :0$ 0;PB P ş 0$ ,P  ձ@@rS6@' wSa6@Xe08PSS*!03>0 SP0  ᶱPP 90R`S`S* 姱@@08pS!*|4< =  l46 d4 \48 T49 L4# D4 t` X ჱH倱P #P  sPP9 3R*@@mS16@sc08PS#*04@0 P4 0# 0 4P DAT>PP90S*@@( <lP8 Z90$0 S&60(00S{:R@` @0P  0(0`@$0 R(0SD0Tb0$Z  Q 3Rp X 0C0AS 0 0 0 0R:1`SP 0R"P0! аW 0%R $3@P!0 | Px! p 㹰巰 00R 908T301,姰WT2R,0',0S SWR H <īPqU>dddddddcdLdLdɥdVLdZLdLdZMd MdZod;MdTMdMdMdMd0MdMdMdcNdxc[d@-@ HP YH PD P0妬ЍdP ᜬg[d[d[dRp@-`@RPP幧Pp@|屧P l00sp@Pp0V<0u8'00Sm 800Si !J!00P00H00< @00PH @! LDR 0U ΦPS `QO $ $1/PI八ᱦP ᬦP ᧦P!V8(0@ 1000P00 H08P @<0+S@ppū<0T` 0S W 1S C 0c`$ Q >]jPHP@`mZ|40Ӛ?2c  00b.0P0+ s)@@ @, 0(0R0p$0,(0S00[0S* X)[ =$ J@  Pk3 0 @@T@A(0CZ,@D T @!dP G{0, , d`$ժ ,!4 @04 FEJP㰲 0  ᎦP$00$0p`!=JPh1T0   0!&J$P  ԥP ΥP H @0JH@ 1@ 㽥P _H @0IH@ 1@sT n|kx`Q ؤ1/P 0@ I@ @HXT4Tb0ဥPV HiP Pc@Pq(^kP f@PH XQPU \Q 0T 05/@P30@1/^\dd\d@B2]dߎd]do,d`]d\dg]dQ\d]d]dMb^d]d\d\d+^dD^dydN^dk^ds^d^dd^d//RM-`BPp@䲟00S P00"P" 0[@oЍ C R񟗄```,`<`P`l````8`d``OoBWOoBX{ @@@0pp@P@ޤڤ֤OѤP@@ & @!@DOoB  @@T@  @T@@  @T@@Ө  @T  @T@@0.w@S S Spg0 `V Qg MXZT@@c P0 PL``h`p````x````T/P SL/D/@/</8/4/0/ /$/?_dwd_dM_d[_dk_ds_d_d_d_dPp@-P@ P P p@U U T T Tp@PEݨU``````ҨШTx PTp Td`\XTP ?_dSLd_d_d_d_d_d_d_d_d_d1`dO`d>`d_d`d`d`d$`d1S/E-@Q!gl0#4(Hp 哨P# 0 ከ1S$ 全!|0! S0#!wC/0BO #4 Xm Ѝ ãPΰP!)]Y`dv`d`dZod`d`d`dE-@MPᩣ`K, 2Ap, +A@P, @ PB,9 AxPC , 0A4VX0  Ct* W 0|  `00!00CS4!4!p(H`!10hP  0 `, @ PЍ@P p@ JPFPD0 ?@P @P @P @P ~00 j@RLd ad"Ydcadad!addd@- M@  f Ѝ@-@ x_CPЍD0 dC;@P D0 t?4/Q/@-M@@< P ᑧލ0adM-P剧1@!  10010z1S pu`p@1SDЍMg4d !(`$^#!"!UX$1S S$N䰟J`%1 S@*0  =+10S S S10,+10S.h%,# ` pnadKad=adwdadXadadZodadadadadgadjadad9`dbd;dbd%bd3bd@-@_v, ?PЍD0 ?P ?P ?P >P ?7@-P zBP0@ Ѝ0D0,@0,@D, 0R>0S [?P D0Z?>0S꬙d@-eP"0d`R/p@-`MP @١P @30S4喦Ѝp  ɡP 劦c 㿡PU V%|c20S|  㬡P$ 㢡PU˦@pZp@P`w L ㈡PoUӳ峦P\`P? 姦 9PP0SSESF0C S8``````````(````f0C  Rtp@U* \0h #0TdX%X $ zp @@@@0h 0ܥE PЍp@!x |0Ѝp@-dXdBbd$'dSbd[ddebdubddbd+d`bdbdCdbdcdcd3cddd^ddCddGcd[cducdcd&dddddM-`(2$p@.lW. W@( WP# `Pk 剥0#,,#4 <0!SPtvЍP`00SH20[0W0S()Z ]P  VU%*0 W GHkEk[ [ 62d_#l) 0AP LR#0d%dchdgdV'z(d(ddhd^d(dydShdhdddhdhdhdA-pQ` -R p @0h0P0`FV fSp 0SA 0 ၖPPPdd@-lPRA-@PD`B p)P 0 A//d0@-0,MPP 0 0 0 (0P  *@T \媤@,Ѝ0@0 PPPu@P"w$喤@d ididRA-@P0 -R0aS@DP tp`V@ TP @ @q@Pfp`Zid9idM- M0 ` 0 P HX= @ -RF S4H [ZXpG lPB 㢤X@eUPQ T\ @Dp= /0PY P" ЍdR bR cR rR tRSN0 SI0 R@S@0P`U@ 0 R0S @T@ X`&0 0 0 P@SPx0xϣU`&0PC0 0U`&000(vidad-jdKjdididjdd4gemjdjd@- L\@-T ^  tj@T aT fT @( \^ 6jjdR-,M00@ 00 0 0 (0 o,Ѝ/dE-`,MVP0-S =ᰞ@P\(T!V0000Sp0 0,Ѝ`F0S fS9癞pV@#pP30   BQ PWCh000000(0Pp 鏓"0S(0 jddd(kd4geBkdR-0@-@0AMMAލЍ0iP0P0 t h YP0L Q  i0 P 0/SLdnkdukdR V/0/d@-P000 00 Q, 0S  ;ЍukdM-@M@ p P` BR'-Q. U  mW`F@A P |0@`Y P0`1`}@ЍsQ bQ cQ tQZA pZ= pQ @Z4 V@ЍMZ' 忢@ P 2 pX00@x@ 0`X 0P @`PX U E < 2h d4ge|kdkddkd @ @/@- @@@@-&H.hP o&g&P &&厞ndnd?b/ /@- @e"p!p||0h | | X| P | H| @| 8|0! | |$|(|,|0|4|8|<|@|D|H|L|P|T |X |\ |` |d |h |l | p| |t| tx| l||0d `ua~a\wa$vauaua|c`\|ancmc|c`Xb`<~c~ccic<c chc``` 0R000/0 P/0/ @0S/  PX:  U!P00000-S =S0 +S00YP [X:   0pS L``@=9P6`@՘`l odA-PPM@% @T" p 밀@P 0S Y`ḘĘ0@0 0`)@tD0@Ѝ0@0 0P@(` `Zod@dM-08M@S `Pp0(0$00 0009 R Q R Q 0R RS 7 p8Ѝ00CS &0P00 S0000000 0VPPU PPUP0S@@T 00C0? 0 SR 0SN0S Z00ZL 000(0ဘ,0J$0$0$0P=0(0 0$ 00P0Uj(00$ `P  0 BS/o" Rf ?o2QQa R00S~0 0 0 S SW0SD `o^P0S$0 0S  SP 0PC0`a 00l,0`F S(粗羗 Ɨ,0 0000P~ 0 0S 8$S 0  PU p 0 S0S0000000S3pp 00S 0pS `Pa,0_,0pPXoob`V; P=`ᥗP00`g00S #P0P2 00S 0S `Ppp`G01S 00C0p1,0014040`P RV 0pP0` 0S0S0000,0Hp0,0[W0  %1pwI0!pCpp0 j?04p,0VP` P0S @ ߖ40p0S ז0,00[ `; P ,0粛6 00PA"x0p 00Sp 0S?o2 0R00W 0 W0 0 ` 8dCd4d@dodd**d odM-8Mp@ X `P4p$PP(P0P,PD $4a,,6P0 0=000S 00 03/pP? 50Sq U 03/[ ! KQ^R[ZP\ U X0S(0S[  0KS R [ X X;R9(0S6P,0S  c` v s `4RL `u  04Rf00Sb`V`8Ѝ'U#!UU h3 ,0PS0S000 000E"PEUta`aaaa,a\U |U ;U}hV 00#03/ PpL 03/z  G 03/ s03/R00  00003/0000_P0Sv 03/ o?P {P  $E 000`$] ZW 03/P 000 03/ 03/}Pp}Pc=00 03/'PpqS0SQ +0/o"0 &ZB 03/g|Z8 03/]00 03/Pp 0S( |0 ,0S 0j vL0  c000p0Ѝ a`@dp@-080/ 0 @8  B8 8 . 8 8 H /H05C:C0H0//@-0  80 6CL0P 00  p R @-pll00#,Ġ ,#4 < p l / @-pd@-  @S_pd3///////////////Q @-H L B H H L 僻/l0S l0!<<!0000t0tH00C0H0H0tp0/H00C0H0H0P0////M- @ HP<P!@@<0\ \ 81 3 #S41 B2s2 Bs0B0Q0CL0C?B!c 0 B~ `b0vp07 P T!00U U813 #S41L2s2Ls᠑ࠁ0L 0^0C0C?L1c  C `c╬1t' 1p7 Q 0 RP 0, ދ Zwdgfffpdd4// p@-0 0PP4P@ @44 8 p@H00C0H0 00p@-HP  `0Sp@@L@3/0P  B՗cpd///0<00/0 0C0/`eHd@-@- /qdD@-6P ^0@l,]  ^J^7qd0dd!d@- 28哗룅,受(南0 列 ЍHqdgqdZodxqdT X Thd2@-8@ @@@-/////////@-0TP8<0080`0S @@L@3/0P   BD눌hdpd@-@P` PU*P0S*0P * S@(: PSP#* S t.̠̌x.`Pt&x&dl`t&<NP_p c@P,  P@pWȰ@|y x< S   S   S  , @0J@P dtЍydM-P M, %@P `` P5Pp W p ,P R 040#40   0 01S 0 0  S 000 90 t1S P0<0`0@S{ pSs SP4n 0h d000 00` tP(J&00?, `P,90p80Y pp` 9VrRP eWp1 `dWd 9Vc`s` 9VcP0S0043@T 0 0C#0 0S 0Pt:?0` PV܈0Pf:0 0 0\`S2@01S22p`P 8`1SV0hhd00&h0 000 0`P ݍ` <`{VPZ PP0  p0` 0Რ0 000~ 0P:   00 0@ 0z  3  1S *o  !00SP ]0  g  q   R 4U004ydd\dh ydyd@-#@9 R  /@-@M0h}?00 00  0 !0HP09h) 0h0R8 0h0G ЍIp@-(MP@ }0h10P}?0 0P 00 0P!0 \ 0h0@` 0h0(Ѝp`M- 0@Ph!0M!0R3D 0G@A@0`04 0G@AdpWM h   2 0 0 W00}?0,00 0$ $ `9S< 1 0 09,0Z`09 00S0 0h}?0c0 000!0 `PI 0h0I0Ѝ,0Z [0K ,0Z 0pWvd0@-000@%00 $0` Zp_0S @PU0S hъP 0S 0SS P` Ѝ1S S '1zdM-M'`@P`p 9 0Sip 1#4,01-01SPB [ 09,03/Ѝ 0S/ d00b02000d0 0h0c 0S[09 "0S"R W "-  , 0SSS S X -  , 8 D$娆  pPzdPzdp@-\@P h` 00b0200d00 0h0 0c0003/h`pdM-R MS `p@ "!HAFF0 b h`S'< U X!'(%X!000(%4",00 0400 h`d Ǭ000* 00 0b 00 0"c0 t0 P2/P    00S 0 HFF Ѝd Zp`dM-R MS `p@X "!HAvFjF0 b h`S'< U X!'(%X!000(%4",00 0400 h`d e000( 00 0b 00 0"c0 t0 P2/P    4 00S 0 H)F0F Ѝd Zp`d@- h}?Č00 00 0ЍM-<"0M⣁c 0RX@'0 pwh0to``p1000d003 0b0 0 P6}?0q 00 0P4X0/\q `0gh d0P0d0`aS ` X}/ P  h eP 9 X  Pp} 00 0 Op' 9 wpPP T0R0 0CS 0SdP Q03ЍvdddUSBCUSBSs@-xT`PPU<壈ЍpFP@ᚈ&zdzd0 /`dP@-(剈$@$先P`zd`d*{dA-XD`&P!1pS="10CS9@8 GpP"1 0#1 0S%PS&!1Q!,000 !R  5P 0S 0S 0S 0S 0AS9 ! 13Ѝ+! R*   +! R*!  .!% 0  Q %0S0%00 h0 \0$9CEP0 S4181#81:03IWalMa{{dRaHNaF{dPMaM-MCgh0 0` 0P b0 Ἢ00b0c20$00d0003/pP Xʇp"0S,0:S X&Z&-0, "@巇 0S Ѝ 2 320  0⹪ E⵪̱  ZⰪ 0$0U0^0  pb0 20 0d c0 00 3/P0'p0p0 @hp W0  0Q% b c"  d 0 2/P 00S_0- 00p"<<"$0,0!,,!    | 0 Rp   R  \ Q!QS!030#20ud{d{d {d̪M-`MPC,  `PJ ?@0h@}?00 0@000 |pP0  ˆ0 000<000, x0 @P0 0 pP 000@P C`Ѝ$@PpW@,A@P #P@{d`d|d|dA-`P! p @PTX P @PP@T @ˁP U0 @PQPM-MU (0@S 0`S#0S0AG 0S 3/p 0PS0S9 < P, 0W ]P R 0P2/P 0 PCqUoP 00pt3ۍ3/P 0W P 0 PCO0U0P0S C|dR|dodM-PP:  `@p Z z@P ᒁP V P@PZ p P [0 @p$0 $  0 (00(0A-P,p`@@P  0   U 0 p` (0 JP@P 0 0$0A-@PP 0` pCP ~0`SP vt p0Q R R / /np R  / P Pn Re BQLgaga0hahahaOP[P1     /1@QhahahahaXgaXgahahaXgaXgaXgaXgaXgaXgaXgaXgaha hagagaXgahaXgatha / [Q0P ~P1AQthaXgahahaXgaXgathaha 2Q0@Q~P    P  / /A-QP` @p Q$ BQA= BT@@@DT D0\p  ؄000@T!0 p  Ʉ000`|dM-`0PS 0Q@ S㤠pA 00C0 00C00XdW00C00 S0000PdmdM-08M0pP @0S(0(0('0'0S  00W 000`$VA`$T00S rO 1# P6 m$ P3@000fS!S 600&0S0S0Ÿ&00006  8Ѝ;0P0 0X/P :P0@Smama,rananamapa@mapapanapapaDoanaDoapapapapaoapapaoa0SQ 0AK00  0) 0 ԃ " ZJKmJZe0Za* \ZY J QQ*JZ 0  0b 0 ៃ [*:Z6*x$x A00CZ0:* Q 0J0$*,`&JZQ #o00CS0 P0S  Cr #   R|30SL# S 800S000R #Z [Q 4~~P  ԢKu" n00CS0 Z:0 0j~ 0   P 00 0C 00;0 0PP 0 M~"@$` V V,qaqaqa,raqaqaqaqaraqaraqaqaraV8 VD V- 1 RO VD00d$0 P @@$0@0$000$0` 00 00 0D00 $00C$0$0S0@ 0 0$  0S@0 S 0$ @$00$00`0@dLeLedLeXLeDd`|dwde|ddLemdi|d LeM-M@Pp}0$ PUPUiPDh\QS`@'V \KPE`/\V \ [@N `\S S# \Q'V00S0'`$VQPE`( 0 {V(V000 U `@PPE@ p}V)V 0H C Q S0;0CH$ P@0ppPE00S U00ۍ040/Qep@-$P@<03/P p@@0/QeP/0 ^30Y/ R/0 A3080S//Qe0Y/ R/0 ;30Y/ R/0 000/3Qe(0S @-3//p@-PQ P@Pph0TQ Tp| P | H| @|08  p| ,|0$  ppQe$vauaua|cua\waP0<0//QeP/0 2P00S /0S @-P qP 0PePe 0 /Pe0/Pe0 /Pe@-@+P0p@-@P0PP p@0pA-p@P`@|P |;|P h5|P 0 U 0l|dr|dy|dd 0  0/@-@Qt p Q `\Q @H@ɀ0ŀ@ Qe|d|d|d|d|d|d6dp@-@P00ST U  P`@@T000pHU  R/o"HPC H@CUT dQep@-P`P@P `P000S$00S:PppPePePe 6PePePep@-`0PPN@@DN@JD T00Pdp 0@SH00@8p0$ PEPP00C0pddPe!PQ/p@-@ Ÿ 0@P`U@T 0C   010^p81p@T 0C Q  Q DP00  p Q p R*    A 1 0p R"182:Q[ TQ"nUQwxQ"|~^  A@! 0^ R: ddPedT  A%  /P 0SM-U`~V*  BP1 R00 0 00    8`4?0 S&380S[0 TS&6n0US7w0$S&9|0~0 !BP   B\0C0P3 N\00 0  0\ 0 00\000 ^*!B L  C\ :0.0 Ap Pp000 0BP HR838#@0@sJ@N@@Spp ["Z000q G2p00cp@0CN@N@@3p "@00Zp0z X0  0 H000 0X  imf ^$.#18 2:R[ TR.&n UR'w AR.)| ~ @AqW B!Œ p@ i@W   R p0  fLX00 0 0 0  0 "X 000 0 0 I0CPK O0  ;0000h0@@@p h00S0\ S00   BR0000PePedTdPedPePePeA-0p`@q?o2?P& P #  @R pGorp#W  B$RR R 00$R  0 0000000ᮠdM-@QpTM40 Lz 0PS` VD3 ^pQ+ A 0p0 00 [ 0 0 0 HQ0 00000_p vPRPJk ^ 7 Rdp   F$R'R R @  $R   @  @ H  00 00uQ1[- 0 0  0 0  F$RR0R00@ 0 0$R0 0000@0 @0000000!wU [upP7 0 G00Sf  F$R!R0 0R000 0 0$R0 0 000 0 0   <000F|ddA-pQ+0 AxP`A*P `!`3X PP@PQ @FPP FT*u@@EQ pF0fpppG0GS0p@G00C 0    00@@T@000CS000000E@ * /0 00C 0a0@ Q*@-O|   /}d0M- $pX"@X@@T|`|8 P:q  B0,"|X|,}d</-----P @P///TQeA-`P8pH@@T @D$wHPDP Qep@-PP P@P@pP @-@P 00H LTL H0H0L  Qe0H H L / Qe-TMP  ᛞPv00@000<040808040@0 ,0<0-%TЍ䭓daaaaa qp@-` P@PPvp@ ៞00P_pRA-`@pPA@P0o{PpV/Zid@-@ 0P0P7(dQ}dP@-TN{p ?0P0D{ @ 04/ :{\}dZid}d@-fyM-pP`@.wvPPPE}vP0J*`ZX PvPkvU `@`0  B0B!@ddm۶@d@-@ 8z0zP ! :}d}d}dM-MPS@S100 M`A 0SS""VpP0 ( $0 uP( $0p 0ZW `PU 00 `K!0`FqNPZ 0 zP  eP `0Z z` `}d}d@-  \ P<080D<`J9` 5nd\Qe]Ued@ddm۶@ddZodp@-@PMtP 0P.S0Pb0C0S PPpd- /- /@- @4/ЍM-P(0p`>P @ T @P xPЍ @0 SЍM 0RP W t 000 ;/WP t0 u00A~dH~ddZodJ~dm`m~d@-0    㦫 PЍ00@ R/a CRWC/A CR7C/@-@PPM-@P`0S SS[  P Ѝ0Kp [ i\aaa@aܝataܝaaaa@ P ppP ppPZ:PppP@@000P0p@000Ppp@@0@ PpPp@-@sPWPs}PPPpp@-P Ѝ@-B*4S 0*4`pPH P`UU 0ES2aĞaaU$4p0W$4/ 40 4tP- hP) UXQTPE;0p`44S0P (4S 4 $0#S  4P04V ЍsP 0`0~P(4$S dWQh0 "448#8S08#8Q $0R`Weh[ei[edWej[ek[e`[eM-hB0P 0B> T*T04PTT T$T8T4T+T8s,=P w?(40SC>4S+4 4g ı p`P ^ 0 4W A\J7 AuVpGW0 (47s(4SC40404S ,r04PB`V p`(PP4S/4 $0S0 Q  Q 0Q  R  ABQ xR00 AAPA ^Ua AR\ 0S Q40*40 404ЍuP`We~d_ dM-Bp`)4S4SVS-+4S 04S ,r04P0004 PPaQ+4S+T$ 4RM0 Q*4 $2 44S 44S9)4STUUP D4`F0C44p04$4P\PP00SS4S PP Q $4P\PP0C48$ S0C08$450C0RP'A[u u84S0)4t(4SC.4044P'0)4U+4 0#  Ps(4SC404`We/P@- x@40CS0)4@4/P@r`We0%'5/c~dp@-t t00C l@RP T 0R @03/P00p@T@` dPd dM- 0S, @9QG QD q| ЍM]u'Q 3Q Q fQ E AR132 E0Z (xQ Q>uZ00E000 h4udd 0S T_ Q?xa8a@a@a@a(a@a0aE0Z uJH`V- 0S* 4 P**5u0u#{0嫁᫶S'Ue t00 0`xtЍlhd`tXЍM글ddddA sdd0dddVddZod?dgdd"d1d6ddp@-P `H0PCD@ 0P0Tp03/P00p@ dPd dp@-@PPp@t`0KS 3S S 'S 9S ES| t0Spp@/xSX ZSL fSD S8 ǀddddd*d.dd d6ddd,`d#dp@-@P`0P 0S  3/Pp\p%pp@-PP0@000LP,Go Dopdd\dM-@p.oPP o@E00P@t00S`  !t`ЍZ  t00S l  I@P00` P@ 0S 0ES)gddM-P`MpT `ǖU :PPs@`Ѝ1oP `oP :oP  Uo J }@P sZ R  nP t R0 . s@0S7 ,0S; P #@P UL \ R\ UT  ┖ PZU[ T ኖJ R Z z z  @P; `s R Ws@v0OoBZ@T P Hs\@g <10S4100S00 Q1QR1 3 #20JR ,` ]nP ss:  @ Rx   R  dP!PQ!3#" 깁dādadgd߁ddNd d,d̪dddjdM-p`TPP@ 0S@ %@  nP @0S 0 3/P @0M-PQp! #nP Kn0K  ` uP @PЍD r(00 0@P rd߂d@-0fS\  ESP  L SD  89S 0a0(_r Ѝ xSdd dddd0@-P\M@ PP0S@T@\Ѝ0A-p@P6 0<0S `0S  SPC0 0A/%M-p@P 0<0S `0S  SPC0 0M/%M-p@P 0<0S `0S  SPC0 0M/%A-MP` P&p堀@, P @ 0q nm0  P~T ,@ P @TЍdd1US)p@-1PS&s/ 0R R0PS @S@QPpH 6lPp, RlP dp/p*d.dH-0?0?0 0MPP0 @P K`Pd0S1Sd`h0M-MP`p0 W00 0M00^qK $0   $0P  Nq!UPR o/ @,\Z^$ Q  \^ <0 0800 080 ,l0 0C?o20R0L00P0Q \  \^ p@R \R0 Q80T(P00<,0Lk4dddddd@- 0g ЍM- M0 X00 0M$ pK7PP0 p,P  pP !Woo1`_P@0 RR AWo0 RQ 0SI@T0 SR 0W$0 00$ 0 `V0808 0 R \0R0Q8 0 h0\h`  00 0D RpW SR 4ddddwdddd@-@ >p 0 aЍd@-@ P!0 S M-p0 S SS`0 @P0S W  p EkP W  0p("448#8ጠ0 [ *0 P0S PP #kP W  000SW  H0G I0J0 1P W  0 ꐱ  0 08R#8S W t 0US0S W H @,j @  0 SS QS W z x RpDSPWm  h0STapaa`aa->0  Q1!0  0#1Z>0?[edLdRdvd[eddddTddddxd-\M0 \Ѝ@-dM0 @p`8odЍT4oP`P8p0 00Pp(o0 pԅdd#d00E-p0`0 P0@P,PE0, 0RT 0S 0S2P Ѝ@,P,PEp@-`P@PT@p0S@P  p@-@~P0S p, 0\/0 S/cBd@-`Pp@iP0avP Ѝ@ TxV@` P0@0,@D, 0R ?0PSwPP ,@cc@-@`P cp P p0S U@ PT Ѝ@- K@P 0S@ Ѝ@-XpP@ 8p P` 0S In@ Ѝ[d7@- P"@P9n Ѝ0Id7@-@P\.n pp<%n@ Ѝ0P@P 0S@Zdgd0<0S 0S /%//xp@-@P p@ p@-@P p@A-`p PP0@ Ѝ0S0S@ ,@0,@D, 0RPE-@p`t0<0S% 00P0 jP0 :/V@00 0 ЍA-@pP`J0<0S 0 A/%xs@-@ `PnP0 Ѝp@Ѝpxs@-@ `P[P0 Ѝp@Ѝps@-`@P0@P,PE0, 0RЍp0S0T@,P,PE@-p PM-04P{p @T 0 `P( @ I@P 0@ 00? Ѝ `W  [@P@ @,@ 0,@D, 0R@ 00 S|0 00S00h   R 1( R U1< PP3P#2080p0` 0x0@0̪A-0M @ `0Tpl_hPP @ P00L00H00 0 p|@P 0Ѝ!dp@-P@P  p@-pPP0@,`,`F0, 0R Ѝ@0S ,0@,`Cd P 0P PP B -0Q 0C?o20#S A0SRࠃࠓ S0@-00 0A-,pP11` dh@T*01010S0SS11| f$ (ЍZ T D@[$ [ P !aP [ 00   `p P \e W 00 0S P@  dddd'dGdA-pQP P@TU peЍ|iP 0 m0P0U0S``cP@fdp@-`Q@LD0  P pP 0@04P k<4R[ ) RT ,RR  0(1Ha06/,'0 1 00j \0ilP0knx10tp1S3/P R R R0Hq 7/V e010101011.Z M M MRS>`Hq0 7/ b b b b,b\chdՎdb`dd8babWdMdKddЍdۍdGdIdd ddwdZod@-P@p@-`0 @00P0S R0#R XXY 20<0 0 0p(,0C000p' d dZdA-`Py@  U|p |`\00`PF0H40@ S  Y0ꁏdddA-`HLp@lP0 04CpL 0P0 00?Ap !0h `,0EHX 0 AG$4 HP $ 04G,꼏d֏ddmudfd#dp@-`P@ P  yP sP  mP 00 PP `*Y p80,04000  X(@4Ppd$bb0 R/4000S/p@-:U8P@0p3UP^U Xmp  dp@-@(0QT0pQP ||X pTdd PJHCD0D @ R$0X  p#dpdEd 'kdp@-@(0QTa0`pQPPPXpT48X pPJH@C0@ddd @-M?0 2z x<40<4L40L40`4d4h4l4 04#$$0(8 <"( 0 4$40  &01#36/A-`|@  @0Pp R 0 0`d1h4 8l4 0< @202,888C2<2\ 20 0,0202 0D H2 02 888C 2 <20P220020*666p 6!*t0@Sutt0<4041707t<48 8<4<40<4t 0 606,@ T 84p#80 0 @P0W0@0@$8ϐdp@-PO@x;p0 /ᴐe00S 0  /cee0 /ᴐep@-@۴`0S Pp1h0d1\0Pt H <0 0 "ppppcedcedce@-鲴P@P, 1P) :RP W0@0|tP W\0`lP W@0 P0!z00dcececed dcep@-hP00`@`0 R L000@ \?C"0C" B 0%p )ececececece@-`@&_PP   RP `PP 0 ``0@@0 ePP Ѝ_P%P0 S _P 00P0pLc yx0x x@P0 IdU D00 S Ѝ@_^_P Ѝ@f_5dcececececeTnececece7@-(@PUP Ѝ0ce( (0@-0 0/@Pnace cep@-dP0S pP`0S^_@P4 0 00d@PppcececeA-T`0S0P0Q@T@ Tp|Y@DPce7@-@0Sa0 Ѝ0@a|| 'RPlah0Pb`0 `y00D D0D0 c Ѝ0cebce@b5dcebTnecececece0A-`?o2P0S 0Qp@ TvPp0\d0U@P! TLD"0 S1:d,E< y, y000cecececece-TMP  xLP00<0(08000404000@0 (0<0PTЍd "b!b"b b\"b/A-PP`p?@PU U@P x0 000 $ 40 0C08`DpHPS00 ( , 0 0S 3/P ddU  " 80@ V00W0S`Ad$dXddXdXddMdZZA-@,0P`p8/P Ƞ0, 8/P0 00M-`p(MPU"!0@ 0T3PUxVX  F(00^B$0B"0B!000Cc E(00PB$0B"0B!00 C 0P.R 0D8PC4C2C1A 0P P 2s 00  p 0AP (Ѝcp@-40@SP 3/FQp@v:00S //00S //P -,^ 0 8//M- P0S 940S/ `- 0@TpĀ @ T00&QVTm@:P @ mQT  `@P cd߸dPdddp@- @40S=,0 00` 0  _   1  /  00p x Ps0  d   00|00 S c  ? 0@ W 00 40@0?  d00@-@XP@@-P 0@T 00 84/Ѝ@- @+ P00@< p@-40@S 0<0@00S = dS"<< R<8p@#8 (`,0 `(`Pp> 0@00< ; ;@0 0P- 8#8 PPp Pp  Pp, <0 < <P8#8 PPpU p@P Pp  Ppp@- PPp?M>M @ @ @ @   Pp  @ @ E F,00,0(00(0epp@-L@@ p9 P7P  sD`@  `V0hp e@POds@-@P` 0SS  08 S P$`Ѝp̑dA-@Q`p"PP   Rd8p@-#8@` P8#8 98#8p@  QRp@-,PU 0p@/PH@0 ^ p@ p QRA-`0pW A/`PP0@0 0S0 A0 A-p @`8#8 P1 8#8 {A-p @P8#8 `k 8#8 P`A- P; S 50@0 pk N9 Sd0  S 0?F@@0P\vm``jQ.N i@*dd d@-@pP@@-0@ cP@@-@[PA< @M-`MP PP  00P00 8#8Ѝ0Tq#1000CX "<<"$0,0 ""$,   [""$, H $H""$,  8#8 P T  @P00@ 0 00PPHdp@-$0@ 0CS" $0 CR S S8#8 m  0 0 08#8_$0S  0 090P$0 S'  P08#8A  0908#84 p 09 08#8%#@.p@-0@ h0 0  0 <  @-0@  . 8#8 00 $1 1 0 0 0 0 0 0 0 0 p0 P  888#8S 0\!@@-0@  0 00~0 y 0 0"=n0 i  8#800^0 YY@uw@-@Qn@-0@ E0 @0 ;0 6`0 1 o$0 S8#8$$A ^ 98#8Aڢp@-@- J0 P00 8#8 0  0p@-0@ \0 0 80 0 @p@-9@ 0 t0 0 0 < 9  A-0P EHS$HCdp 㸁`@dH$H 058#8A7@-0@  2 z1 u1 p1 k1 f1 a1 \1 W0 R$0S'P0 I0 P0 P0 8dK$0S  q0 090'$0 0CS0  \$ 0 BQ000 R 0 R0  0   Ѝ0K!D!( F!3M! Y!p@-0 Q<`@P 03/ p pp@-00CsR l000  0PZ $00 0P -  0 <  R ^ 0/ R Q  Q* PA$  R$ R$ $ R $0S @-0   p@-`P@)@0S UP! 100!1E0jaP-P (103 0#R$10C2r"0Cr!0CR0C0C#@0b P P(103 0#R$10C2r"0Cr!0CR0C0CS0p0"2 000<0p! M-p P`㬠@0000 00UV00   00 0 S H 0W0VPEU0000`rd'p@-Pj@`(00pp@-P@[ 0;:;:00S L 000@00p/p@-@<0`PP0QPp@/@-b0Sp@-PZ@LP p蕓d0<00S @-@3/%/@-@ R  /0@-hPM0U 0T0S $ E@P 0S uP 0S h0 uP 0 P P yP Ѝ0d@-0@0 00Q00;0000/0s/A-@p`PdP V80 40000 ,000 @x}! 6   9  S <<0  /7'/@-@C0 R0]CP0  B,ĠCC p R /%/%/0<00S /%//p@-PGd`@C 0P( 0(0 D`V0 (  D0 ( p@D'M-Pp`& 尠0@!0 !0 !0 !0 !0 !0 !CGP0 C PV``W0<00'M-pD&lLM095P@Ѝ0 000<000%0j@P @` P$h +j$0 ;?0(0P,Z - j,0 <000`GX50T5 Rb P\0,%(P0 0 P0 P0P0P0P0P0 P0$P04  # , #WC   | MCp \   RLBC # R 8C QR U P P PZ(0 0]S @@@m0@4@@@D@P@T@`@ d@0 \0 PR0C04P200 000 Tli'0 T00V0B< T B< TxpF0 < <Ezi 0 y Zqi)0 Tp) ThiS9 S ,< 8,(0  0090008171;1 P( i'0(0?20SF0 ?SE0 SD0 SC0400 ({ 30S410 FMP0    ".  d3 `3 0 ( 0 0 0$ 00 ( 0 0`l 0S{  GPPAHEtcd "dldxddӖd ee'0dd6dږdM-(p,0`P0FXH%\*@@ ( 㪢 h(0"r@0?o280! &0008000 40 80 <000 40 80 <0 00 dQ40vj0@>N @>N[ 0>>@@A A00 AP VEЍMRE0$@A@@ $001$0[0$@0A<@0<0\ 000 010TWX ЍM"jЍTd'|ddA- M<P`p  @g'0X 0000%<0@00@%8D0 80@Q: ЍA- M<P`p  @g'0X 050%00000%<0%80A@0D0 80@Q ЍM-0p4@Pp` 0V0 J S0 `F|S0 Ѝ@-P`p@500p0  Ѝ@-P`p@%00p0  Ѝ0<00S /%/0<00S /%/0<00S /%/p@-`0#" 04 P2$@0#" 02#T ^Dp@BdM-0}>CcS@ODp ǀP P B"ǀ$ , 0C28?8 70A20 1PE\TP 0`Bbd!0C2?0ld`\7!0A2880P0d@-@ 0  D# ,##Ġ ,##Ƞ ,#<00C"  00<#"Ơ 0"4 0<#0":"(0 #" }. ;dp@-Pb@pp@-Pd@LPD D< p0 00L;p0 00p蝘ddA-P@,@D,0SD0,@p4<`<`F<0S D0<0<`C00@-  P@TL P@TD P@T< P@T4: @T.  @T(@ @T",^P   \  \   \  0@o0000 0<0(0S /%/ 0?o20/ee@-0 <@T% @0 4/ЍM-0y `< 0@ 0|[% 00P 0 @;/0S 0#S0 4Sp000Ѝ@-0 <@T% 00 4/Ѝ0 0<00S //0 0<00S /%/0 0<0 0S /%/0 0<0$0S /%/@-x@P 0Pp0,PE, 0R 000 Ѝo 0P0T0S``#P 0P0V0S@@,PXd@-@T `xP@M-MMg@@p`pP%-0Ee0 *,i000$Y>zP ' ųPTG? $ 0 <0$P&09LH00P00G0 0!10Cq0WO0!" 00B = P *  0P$ \$Dpp  }P 00@000 ?P  00 0W0C0 2 ލЍ U Pp hP$ R P Rp  0AP0P 0 uP$00a$0 0pddd˜dؘd#d7@-@{PLA0 4P0Q Ѝ0@A Ѝ0@Ad]d d!d1A- x @P'0P`hAh,`Fp ,0S@ ,@D,0S+0S4z@PUjA0@@DЍaAp匿P,`,`FP0P0 OAD0 0S,@@0,@D, 0R D0 0S z,@ee9dXdodBdWdp@-P@`Q,Y0 00p@m%-)d,Yp@-0000Sk/Xd! / h000h0/000S/00/Q=PA-`pP@H=t @T PU@- R @00  000@P@꠆d@-@uT000@A- `PV0 0F2p@@e0# " ql WP%%l  0`0 0PeP諪0@-0000CS @ '0 ;((50 00Ѝp@-@P`\e*. B0V @ 0 Pp V@F0S`A@@pљd@-00 0 0LP1@m蠆d@-00)0(0:P@m<蠆-dp@-0`0Pp@00 00 P` p@d20 1 00 V1P0*P}=Pp꠆_d@-b@M-`PP!00C0<뀀}0@@ p0W 00`0d0S @;Z *,?@哿呿᏿ꊚd0, M-(M, P p0PTT?@(Ѝ U``*?S`V@P `0   PV 0 `0C03 0PF  Ib Eb ! !7l 2 4 < (<0H80<00S-H0Gd0Cd0?d0Sr0 0P00`2d/dP000`@0V ` #  $ 0垮$ $  0 0P@o AQq0#$ 0  0` 0P 00# 0vPdd@ A-@P0p 0`P@ :$Od0T?@P@:T*4>m@W@, P@ЍdM-M0, g0 0S0PS@00 0 0;;SV3 0@P e>eS 0@ 0`  5a 1a0 000001l`$00裧 000(000 ppSpp ̭4 ( 8< 0 =1R9,  R B/o "6010 0pSpp706cp`00XR 0?o27<000<40 0*"**b/ 8 R 4<D 2@0@0D P =Ἵw3 pp0pPx`@@@080,8 U8 @0J`0@p'Z0S 03 P# "   `00 00` b`0 ,0b000b00?0 000 7 90cF#?Sdc b, bbp00 9P:(0` 0 rb00@0 0 1}Pb=00 } 0  y 0 0)1hPl k00  0  Pb 0 R00S 06b0S 0=XPK#0@S0 S' S S @"0 0PS S0$ l   $l x90&C0 0 PЍ0dNd0d'dkdd!Ϡ\ 0R/M-@M, 08xP001 81jS S> S0`1@  04#$R R RB `8 0T U PUPTU G_Y ЍB'0`@`0`0Sul"Ah"`0 4 0`@ ^000000000000 000 00003/P 0P0000`       0001S8000R*0 88(0000000:00 ;`*00 $R R R R.0R R1 810000 0:0 0 0 8PЍM##d#cd˛dM-$P@p`B4VW00P0S@P<0U0  D^20202020000S200S|200Sp200S Xp`AP000 0(2 KPP0; 03/U1Si00j `` ]0 0 :p$0P@00p4p80`0`` ]ppp`0S5PF 0P P0 S_ 0 00    $  "$   $  "$ 0000 0 00@00 @000h+70!( !P:y3/PP 0  Pxbxb4ybybddd@-b0S 1 1  7'PE-@QPp  P 1! 1a|``P !8:8:8000 0 Ѝ Ea2~6.0`0SxoPl  d0 3$0 R0C0 4 200 00p0 Pdeedb d!M-`Q5 p0S1 5 P0S( 0 @D T#@ 0R Z5P0=S P@D R !%]T:  H:Ѝ@Od@-@:@8@-M @9.Ѝd$0P  d@-0(M@ 0T 0 0 0 (0 K*P(Ѝ Pd7@-P@P (:0S Ѝ0@-@ 0  0 0 0 0 00@-MP@P x9ϖЍ0dp@-P@P 9p胜dp@-P@P  p@9p@-P 0YPTP1S@-@o襜d 0 @-Pd@-@P pL90Kdd{/ 000@+PD0DЍ@:9k   ) Ѝ诜ddd4gemjd@-+0  {/0 +ЍddQp@-PM`  '\ .0P |)Ѝp@PX \0 @@@x+PP 000(0(8 ݜdd4ged d@-@Mhp`P0\ @@p`*P8088Ѝ -d4gekd$QgݜdM- MD@p[` 0$SU0{S` SO`P[00@P 01 (PP1  'U [00 @001 Ѝ0300CS  00S0[p@0 t n3 pH0 {[ [0H 000\300p@d;cd|d!ddQ /@- P 0000C,0PRd ddA-p`P@P_@,P(0 2  803/@P$8,`*tuP`$dyd@-,@P `8 0ST ( !<7@3/@P 77bddDdUdydA-`@pPP V@ tl @ $ 0S 3/@P(01(0(01(0t $0`S@dM-Mp`@3 00M 7 #K82P5 (010 P pM2 0 #KR2P vV 2P 2i2PP 2РKYP Р  r7ꍝddM-PPpP ,2`P)20P8 Ϸ@P PW2:2PP 00,P,2P  7/PPVPPV P⣷@P 320 0RP0@-0M0@ PH 0@P 0S@ 2 Ѝ0bP@- 0\ X\8@0Q P D^d0 /p@-4P@00`* $m ipdbd8bdp@-@)2P ,P2P @p 6pddp@-@2P ,P2P @p 6pd1dp@-P@0pc0@-0,Mx 0 0 0 (0 @ '0S T0 ,Ѝ01P P d7@-@P0 m0S  S 0R XR U :P@PEP` Ѝ00A-需000PS`p@PP tdPP\ P Ѝ P1P  ddfenddM-PRM`p@0QtBd2Q@Uq 000CS"bblbbDbb0 00S /0 0 R& S00S00XS 0GUG UM UA= C01SyS tSXS0S F0C0S@!  8180 5ЍY0C!023 00 0 S [  .RKR)P0 0 5  d@ -,@ P@ 85 0P wd dAdud dҞdd0/A-pPD D00CQ`,@Uچ0P`dddp@-4P@00( $ pħbdb'd@-0(M 0 0 0 0 (0 @%0S T0  (Ѝ0P P  0dA-PM⨀`@ PW0pS ,P0P0` P ܍ P S0P P00dfe@d'd7@-P @P  Ѝ0Kdp@-MM@P+ CPP' `0*G@P@P|(I@P`0*9@P40*2@P$۲ᅴڍЍpkddd7@- ԷPPA@ Ѝ0@P 0*@P 8._+`@P 0 $ ꘠dd/p@-@P P0 v)0P   P$ pp///// /( 0P 0D P//d///E-gM` 1Q弁p3/@P W0\ 000 U00Sl P+z* >+V 4@gߍɠd///0E-`0 0:PP@xxpV 0SSP0S 03/P40 ,0P ЍpWD@dfe fedfe`feA-`QPx oP@hp`P`P 03/P H0 @0@`m@TDP@ fedfedfe`fe@-@[$03/00fe(0@-P03/@fe(0@-C03/@fe(0@-@603/@feA-PD0@'b000 0``6/@Ѝfep07@-P@@,03/PU 80PeP Ѝ0$0 0 000fe4gedfe`fe@-@i<0003/@T0@d@Ѝfe4ge@-@PQ0403/@rfeE-PP"0` Ѝ0Sx3`@PX  3 S 3p 3`p4ged+dddR7@-@ P@P @ Ѝ0 SPdM-`0BS0M@0ЍRP @P 2@[B ,30 RP 0S[= [pB 3[p;3  .p1J 00`0UP   0 `6/.[`2PU 2PPp 墰 "i2V 嗰$0 ,00(vJ(( ?,\ !%&T兰P僰HT @Qs(Z'Ddfexd!dV3d\ddd]ddZodhddp@-@0BSRP !PU }Ppppdmddңddfefed@-@P | 000p0 h@P X 000L0 D@P4 000(0 fefedfefedfefedp@-HPH@P Q _00P k00p@fefeM-0M80 0PS4  P;0[Sq  ~/0 MH 0 @P< 㛰 @=PT3 000[$`0[S# S``408 SR00X00S'  q(P;80`40@0KS`S`` P`0j V0 V  V0S$ P 00V V V- -߬02[p0S$0K` 0,@K0  0 @.Pu2[St ,np\dcdjddqd7dM-0M@`0 40 0((@ 00M0,0 ((P 'P0/S S00@q / (P0 ,0(`S PC 0/R ,0K( KPKp ,0(PS<p!00S0|0S P   8 帯8 pZOW  ;R*,z'0[0/SU0`_o,0K( KP;U EX 0S0 (004 ,00$0K 00 pP$0 0fefe@-@00X0 PЍ0KP TPTPfe@-`P0Q0 xp 0_0P @0S 00@ Ѝ P_fefep@-@ T1:P !+@NT' S`P #0RL0S0 0 5 0`0? 01-P|ARx![P @pᚫ00pfeSp@-@PH0@D0DP CD0`46 f1 F525V(pfefe@-P`p@0 D8 Ѝfep@-@s[D`C0U p@, 0S/P/ 000^d0H P/( @-@ ̽T0gefeQA-@0P S S4<1Q=4I+2Q*0!C`@0S \@ P`0S& S! S0   Q* Sq+C`ADq#C`p@D00@zdM-QM`@!02*P% & 1HРpp!RРT'K0  0 eP Р!M1 `@DQB p NP!`@D! p  & !1GРPP  8P Р MР1A-0S@p@ `ȭPP  P@b@ M1 S@@ 0$@00M0@ S P%@P@@d<%P 0 , %P0@00gedddE-dM `@ pP) PD00 34 0304S(0@0(0(08!S0(000+P,0开ᑃ(,0 TU-0Q1 S!*pdЍQ(* Pム 0H0L0 201#B0 H $0000 3P @$000$0 000fedd dH-000 0M`@T @L dP 0P0K H%PP8 6%P $ R%P 0gefeP@-0@SP 020C00SЍ0C00 00M-0P<1@P(@Ѝ0 0 0(0$ Q %  R@ p @p@ ,pWO*0SS00  D ,0#0 0P0/o"X R,0<1K "L0410p  0 G0 .0`0  L 0 p00p0` ,1S,! S0,1<1S< `0P `VQ ` V Q  Q ` `[o v$ 0  KE@Pc M-@PpK0`SP \S/S #P P0S /S\S0S  ERH#P0$  $0000000SR EP <#<[1 ! C#P <1S :#P 0 1 P! (0S00 00$00 0$000000000S߸d}d@-@pM0S Z|&(0t"(宲 0|@P L(@pЍ &K & @+@ (0ge?dRdzdbdzdp@-\0M` 6@P PP DPͧ˧o0Ѝp@A-0Mp PP @ `P@ 'P00 孧 v@P  @P0@H坧ᛧ0Ѝ@M-PM @ pPtxp`0P0 00Q P0P0J 0P0A0$0 Q A108V .UPU P@ 0P?0V0"0 0U PQ`V000`  U  00嘪0P 00 64PЍ h"P@\J'$0 S2 S0>T*0P0  090P 1' PU  S0  ;J 0 00 00 0P@$0 S2 S\1>T*`[ 0 P0 0 0   @Z 0 P P$ R" 0R .P*0 00`  0 0 PU   0kP@u$0 S2 S0>Tl*`@ddA-p` dPP @ P IbK@P @PP trp@-@` P;P -dI!! 0000 !`pp@-@N@K/0@-lMP (@P0000 0?&lЍ0蹥dM-PPM  ML\ʂ\:Kx>&Sj A0 $0   0 P 44+&$0 $ B 0R ( 5I( `p@DT 0 c 00 0 M 0 u IР20 hZdh0a@ 0 `> 0 VP$  H˥ddd d'd-(0LR0 4#00 #cs@-`P@PЍp0 .RVDPUD`!&PUD$ 4 8$DL7@-@Q PP &0S@U@T Ѝ000 P0  0B8C8/ @- 00oNM-  B0@8M000#03P00S0000 0@0C(@A (,,040LPX T8<$P@ $AQ@> @@0  P5 202> @PP@ `@Q@P>@ P *@@Q`҅ 䎀 @A@>(@CT,`DQ *!B \ L B  b S %0B00C <2결@{JXT @^@P@T@EX@㲠Ჰ@ T㲠`V$P. PpCp#  h# dC$ `#  UP!U!1p*  @/o"P *[RP3P"U xЍ@T x@ంT∀ᰢD`` $  * B(   A`@Pg:Th:@D$`@ @ @@A`0 45 @4 ``@0` [AGP@@@x@PDU@DH$HTDEQY ,@ Q)(@P@T$ RP A8PPlPU*PPFUP\P`P[VP3P"U~P@PQPaPHEQPP @``R ( \  p0a@A̠\ LPp @`P ! &d(ccc P 0S 4) S. (,08<l P L //R9 <S1R  3Pp@-@p 0 S(0$0  S0$0 0P(3/P U0Pe0 E20/U0$0( 3/00P0ES0$P40p@/pbb0%@-@P  R $0S 4Q ( 3/($0 3/M-RH M` X$H 0@3TLD@DPU\EPE,Q) Rpp2W$W  Q u0`ppV:@:P0@PVX2\TLD@D: ЍV}GW=0pG 00RRR0 R  R0  R  R 0   R0 R RR0 RRR@R0R 000 0 000 0@00P0 SE:Vm0`@?:PR0RR0 R0 0 R0 R 0 R0 R 0 R0R 0 R0R 0 R0R 0 R@R0 0 @APT0@PWM-P0M> @T; 0S0S508` S 00 0 000000 R&4000   ,bP0`0U 0S`0   ,,`P0`0U 0S  0&$ 0   ,bP0`00; U 0@`S`0 P`000 & @0W1![ R P  A \  B C0   @0 pG 0C @0@0S(0@0000;d W J 0S  \ @ 0Q02@057[W0    _ [pGE 0 000p(08`Sl0L00T0/>0T00 l0p0P060h000`d000h800P6cPE0 h0h R0*TL 0SWh 0pGePP PzPk6c0EaPC0XWP pGePPR6cPEFh50000S S>l0L0T 0/T0pl0 ` $0 Y 0P0$05fl `P  X X  d G0P04V004 WR9T0L0  R1AW 0pGeP06&aPE\!@ P0*hwW pGePW pGePP6c0E cPC 0 000p8`!># ! @T ЍM P# pC'0 c5( > `!PCUC!c6Z 吺. 2SX>W U \;A?o20S PE (0 0@S U )dddddM-PMp@pt`@SP@#@T#@x 0R3!:   Tp1 `Z@D04# 0V&0 .@S P00HCy PЍU0 1 U0000 0 e  `0 `  @0Hd"d^dQLdM- MP@p@S`@v#PUp#P001(0 !(  01C Р0$0 $0 0P0m, $n ㊉,0@DpۉP K T0@- R 0 R0#01 # 0 @PUS0 B0` 00#01R #0  ..  .. xc@-A-`PQp@"`F0@P0T  T # 2RW :pW`0?@ OP@-)d0 0 /^d@-@0P 0C40S *000C ^d 0 # BR /  0M-^ 0Kp0` P PPE VX@P TЍ[ TPN US0^ 03#0N2&*QY@ 0C TN@ @@@A@ P U TPN @$ @$`K`U 1@\VPP0S pCQ@ P&U( `pW  p[#!pPW ` `r@@@T 0@C$0 0 S vE-@0 $MPt` hp 0 @ S$Ѝ 0000S  0 Sdrd B@-0 ^@ L QT^0@-@  @ꥮdH*d_d/00M-PȀ`Ap @ \ X( ^T @U@@D3#VZ p^ >.00C0T>. <# PEP D0M0A-@@\A PH\P`q\```L Q\0B C   @ A U`M-` "0F`  p kP S( R:Z  B@k X * # R@e @e @ T T 3R0C `F  05 0P 0 tP@Ѝ r"@U@Dp@-P`@P p贮d0p@-P`0P S# F 0 00CRP@@p ^Pp@- PP@ Q0 0CS%0 00SCp 0Sp/0p@-000`00@ @RP <H R D,Vpp@ABp@-P0000@00,Upp@-Bp@-`PV @U:LLQϠ\ RPpR QáVQ R`@D@DQ!R  A- @ ^5PB\p*XR00` V` V ^ `V ࠑ000 S    /2S0 "2/d2S 0"2/d0 tP/mPSP dP 0P//n0@S]c]c]c]cp]c]cx]c / / / / / /p@-P`"@ B202pM-0`4p@PQ8 0AS`^c`c^c`c`cdacac4acPacd_c_c_c_c0_c`c@`cp`c00 0@0 0PP0 000 0@00PP @0P JRPЍ0 CP000@P 0 @PP00@ 0 ` 0 ` 0 @PP 0 `}00 0 @yPP 0 `0 S   0 S l 0@0b0 S < 0 S R0000P ^  R{0000P ^o P_oRU@,fP PE_oR[ 0 001@[ 0 0!00C0 ^d&dM-0@p0P` 0 0PЍ0 0P M-0@0P`p 0 0 P 00 P Ѝp@-Pt2 E0CS 0@20p>dA-P@Q`p0S 0CP0[0WURPE `20CS 0@20>dM-2@P`p00 .R#R RB 0b0QL$B QecccccccecTfcfcfcccccec\RU ?R [R b^R00@^R |RW 7002p0CS 2 20000Ѝ b \Q ]Q   A0C0 R\12b @ sb `0 0)S 02 W00S0*R?Q0 0 C?Q0 0  PI0 x>ꓯd>dUdldd7@-P RRRRR0^0C?o2 2Z@W00S0SJHGo Ѝ0E- p\M@` P   0 000 u Ѝ0  PiPU00\0SR l@-0@ P R P @@   RQ @B/^d  @00S/@ Q/00S/ 0\ 0C  R/R/- 0^A \S  0 S00\0S / P0/-P^\S0 R0/R/0 0QB/A-@R `pTPPD '@00p@-P@@0 SRpUp R0  \C/p@-PP ݄@P@pe0 R/^^ R A-p@-PU @0P  0pP@-@0SN' Q sb0A S/ P/0A-@pw`P sPU@H@ PEP P/0\/h0S 0h@-鉻P@hw@-/<# 0 Ѝ @-h0SkP0 hKP 00\ Ѝ䟯dįd/@-@@@-@H 22< 0B0#30 !4ׂCp@-`@P@P 0P:pp@- `@TP1P!@Tp耖0 6#8##/d0/d @-ʁ뾁0 j(@-飁-@-Yp@-!R!DP@0!6 !Ơ! 5A0Q0p0C0000p 03 1A0pQ0C0000pM-00À P$!Q *M.t .`  0!  J"r"p`""f ++#8  e B0  L! q  e` B0  L # !`F0``L0 B0 L L #GGŧM-`M†` Z& `p@P 2 S) r0Qp Z@D-p/ @D-p Zj J ` @` 2 .3.30@D+pp@D pQ: Z@D @D0000Q@D> W Up5P0S U003050ZPX0PX00E 0S  0 0 R$Z?@DP@D 00# Z Z@D-p  @S50 RZ?@DP@D 0 S50S50 BQ@0 0S ZQ 0  RZT`ЍR 75 S50dA-R``Pp@0 0 CP PP  LPTDS50 APP0D 0c@D0P@0 S 4 50R5 dM-@M` 0!0!#  0%0S  R V050Z030J50F@Ѝ%S V05P$-S 0S3 00C Sp&00C \+0.S0:00@ \ ࠓ,*P/@0 )P0+S S #S *S pPP@PP 1!0pA@pWpgP +0K00@ \˿hP LQZQ zQ tQ 0xSbS%S XS V%03050S Z0ƅFlQlPLc0CSdxc<{cwcwcwcwcH{cwcwcwcwc{c{c |pp0Z|ppp px10S0s|pppTA0 LjH100p|ppp(j0p10S 00S0000 0+ p@G|ppp P0`0`0@|pPp}U\ 0000S0U,0  peedde deddle1deec@-L@00S08lj@,hj0} "@eJdqdc1 A- Q1A0+0taP  h"<0"800 0@ 4q00@ 0S 0 R 00# @ Q  0}%00 |0/ t ЍAeeĐeeeȐetddedϵdܐeede-d@dwd0dWdclceee̐e@-0 贐e@-P@p0 +@ p0 P@`R0 2110310PPPPPX0``P0p 80 Ѝ@kxeTnedDc'me5dȐe|e|metmexmeM-0@S S Ѝ  _0 0R0  Ȱ0S +pP  P PPP `C  ?HPPP`    P*ЍM%xeeȐe@-D@M l f @P 0 0 ލ0dee2@-pWa  B0PRs\clccclclc\cc,@ 3p@1@|1x"#d1p`0 @0S@ 810S( p@D@1! 0 T0   Ѝ+ 0@ "440, <0@, <0@, ;p0y@@Tne eexd~ddMbdd~ddd8eQx00 hBR`00@LL2LB0 0[4pP ("<0"80 00m  p|1!w0S 1 R 00# h AflbQ \|!' fG@P EX1 T ~fL ЍEzf@1@D8tf41ppv$1 1 r 1E 1@e0 0@0p0@ 0, ЍE!ꀙedзd޷ddddd+dd?drd@eĐeeȐe}deddddܐeedeҸd@dwdedUdedld eDecdlcjm Zjz  ' }Dңhi]Wbgeq6lknv+ӉZzJgo߹ﾎCՎ`~ѡ8ROggW?K6H+ L J6`zA`Ugn1yiFafo%6hRw G "/&U;( Z+j\1е,[d&c윣ju m ?6grWJz+{8 Ғ |! ӆBhn[&wowGZpj;f\ eibkaElx TN³9a&g`MGiIwn>JjѮZf @;7SŞϲG0򽽊º0S$6к)WTg#.zfJah]+o*7 Z-2.Qp:Yxʱ -No0 P%@Fpg`ڳ=^"25BRwbVr˥nO, 4$ftGd$TDۧ_~<&6WfvvF4VLm/ș鉊DXeHx'h8(}\?؛uJTZ7jz *:.lMͪɍ&|ld\EL<, >]|ߛُn6~UNt^.> !1Aa  0@`@@A@!  @a`10  @ #+3;CScs`Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O `Psp0  ` @ X ;x8 h( H T+t4  d$ D \ S|< l,  L R#r2  b" B Z Cz: j*  J V@3v6 f& F  ^ c~> n. N `Qq1  a! A Y ;y9 i)  I U+u5  e% E ] S}= m-  M S#s3  c# C [ C{; k+  K W@3w7 g' G  _ c? o/ O      u-boot*EHCI Host Controller* print_cpuinfo__of_translate_addressfdt_fixup_memory_banksdo_bootvx_fdtusb_setup_descriptordev_get_parent_privdevice_remove__mvgbe_mdio_readphy_device_create_ehci_create_int_queuefs_devreaddev_get_uclass_priv__mvgbe_mdio_writedev_get_priv__mvgbe_senddev_get_uclass_plat__mvgbe_recvdev_get_parent_platfdt_find_or_add_subnodedev_get_platdevice_probe(((((AAAAAABBBBBB(fake run for tracing)machidUsing machid 0x%lx from environment Starting kernel ...%s FDT creation failed!/memory## WARNING: fixup memory failed! arch_numberTLB addrirq_spsp start Early malloc usage: %lx / %x Resetting CPU ... reloc pc : [<%08lx>] lr : [<%08lx>] sp : %08lx ip : %08lx fp : %08lx r10: %08lx r9 : %08lx r8 : %08lx r7 : %08lx r6 : %08lx r5 : %08lx r4 : %08lx r3 : %08lx r2 : %08lx r1 : %08lx r0 : %08lx Flags: %c%c%c%c IRQs %s FIQs %s Mode %s%s Code: (%0*x) %0*x undefined instruction software interrupt prefetch abort data abort not used fast interrupt request USER_26FIQ_26IRQ_26SVC_26UK4_26UK5_26UK6_26UK7_26UK8_26UK9_26UK10_26UK11_26UK12_26UK13_26UK14_26UK15_26USER_32FIQ_32IRQ_32SVC_32UK4_32UK5_32UK6_32ABT_32UK8_32UK9_32HYP_32UND_32UK12_32UK13_32UK14_32SYS_32resetting ... A1A0Z0Error.. %s:Unsupported Kirkwood SoC 88F%04x SoC: Kirkwood 88F%04x_%s sysrstdelaysysrstcmdCannot add window '%04x:%04x', conflicts with another window Ramdisk image is corrupt or invalid ERROR: RD image overlaps OS image (OS=0x%lx..0x%lx) Could not find a valid device tree ERROR: FDT image overlaps OS image (OS=0x%lx..0x%lx) verify## Booting kernel from Legacy Image at %08lx ... Verifying Checksum ... OK Unsupported Architecture 0x%x Wrong Image Type for %s command Wrong Image Format for %s command ERROR: can't get kernel image! ERROR: unknown image format type! Could not find a valid setup.bin for x86 Could not find kernel entry point! Image too large: increase CONFIG_SYS_BOOTM_LEN %s: uncompress error %d Must RESET board to recover WARNING: legacy format multi component image overwritten ERROR: new format image overwritten - must RESET the board to recover initrd_startinitrd_endERROR: booting os '%s' (%d) is not supported subcommand failed (err=%d) Using standard DTB !!! WARNING !!! Using legacy DTB /chosen## ERROR: %s : %s ## Starting vxWorks at 0x%08lx, device tree at 0x%08lx ... ## vxWorks terminated confaddr## Transferring control to Plan 9 (at address %08lx) ... ## Transferring control to NetBSD stage-2 loader (at address %08lx) ... filesize## Transferring control to RTEMS (at address %08lx) ... %s: %s Base path too long (%s%s) Retrieving file: %s Expected string literal: %.*s Expected string: %.*s outbuf is too small (%zd < 21) 01-%02x-%02x-%02x-%02x-%02x-%02x.dtb./bootmlocalcmdNo kernel given, skipping %s kernel_addr_rSkipping %s for failure retrieving kernel malloc fail (FIT address) ramdisk_addr_rSkipping %s for failure retrieving initrd %s:%lxipaddrserveripgatewayipnetmask ip=%s:%s:%s:%s BOOTIF=bootarg overflow %zd+%zd+%zd+1 > %zd append: %s fdt_addr_rfdtfilesocmalloc fail (FDT filename) %s%s%s%s%s%sSkipping %s for failure retrieving FDT fdt_addrfdtcontroladdrExpected include path: %.*s Couldn't retrieve %s Maximum nesting (%d) exceeded Ignoring malformed menu command: %.*s Expected label name: %.*s initrd=Ignoring unknown command: %.*s pxe_label_overrideMissing override pxe label: %s Missing default: %s Error parsing config file menutitledefaultpromptlabelkernellocalbootinitrdincludedevicetreedevicetreedirfdtdirfdtoverlaysdevicetree-overlayontimeoutipappendbackgroundkaslrseedUnknown OSUnknown ArchitectureUnknown ImageXIP %s %s Loading Uncompressing %s Unimplemented compression type %d Unknown Compression%sImage Name: %.*s %sCreated: %sImage Type: %s %s %s (%s) %sData Size: %sLoad Address: %08x %sEntry Point: %08x %sContents: %s Image %d: %s Offset = 0x%08lx HAB Blocks: 0x%08x 0x0000 0x%08x architecturecompressionoperating systemimage typebzip2gziplzmalzolz4zstdnoneanyu-bootU-Boot phaseSPL Phaseuncompressedbzip2 compressedgzip compressedlzma compressedlzo compressedlz4 compressedzstd compressedaisimageDavinci AIS imageFilesystem Imageflat_dtFlat Device TreegpimageTI Keystone SPL ImageKernel Imagekernel_noloadKernel Image (no loading done)kwbimageKirkwood Boot ImageimximageFreescale i.MX Boot Imageimx8imageNXP i.MX8 Boot Imageimx8mimageNXP i.MX8M Boot ImageInvalid ImagemultiMulti-File ImageomapimageTI OMAP SPL With GP CHpblimageFreescale PBL Boot ImageramdiskRAMDisk ImageScriptsocfpgaimageAltera SoCFPGA CV/AV preloadersocfpgaimage_v1Altera SoCFPGA A10 preloaderstandaloneStandalone ProgramublimageDavinci UBL imagemxsimageFreescale MXS Boot ImageatmelimageATMEL ROM-Boot Imagex86_setupx86 setup.binlpc32xximageLPC32XX Boot ImagerkimageRockchip Boot ImagerksdRockchip SD Boot ImagerkspiRockchip SPI Boot ImagevybridimageVybrid Boot ImagezynqimageXilinx Zynq Boot ImagezynqmpimageXilinx ZynqMP Boot ImagezynqmpbifXilinx ZynqMP Boot Image (bif)fpgaFPGA ImageteeTrusted Execution Environment Imagefirmware_ivtFirmware with HABv4 IVTpmmcTI Power Management Micro-Controller Firmwarestm32imageSTMicroelectronics STM32 Imagemtk_imageMediaTek BootROM loadable ImagecoproCoprocessor Imagesunxi_egonAllwinner eGON Boot Imagesunxi_toc0Allwinner TOC0 Boot Imagefdt_legacylegacy Image with Flat Device Tree spkgimageRenesas SPKG ImageInvalid OSarm-trusted-firmwareARM Trusted FirmwareLinuxnetbsdNetBSDoseEnea OSEplan9Plan 9rtemsRTEMSTrusted Execution EnvironmentU-BootvxworksVxWorksqnxQNXopensbiRISC-V OpenSBIefiEFI FirmwareInvalid ARCHalphaAlphaARMIntel x86ia64IA64m68kM68KmicroblazeMicroBlazemipsMIPSmips64MIPS 64 Bitnios2NIOS IIpowerpcPowerPCppcs390IBM S390SuperHsparcSPARCsparc64SPARC 64 BitblackfinBlackfinavr32AVR32nds32NDS32or1kOpenRISC 1000sandboxSandboxarm64AArch64AMD x86_64xtensaXtensariscvRISC-Vbootm_lowbootm_sizebootm_mapsizeWrong Ramdisk Image Format ## Loading init Ramdisk from Legacy Image at %08lx ... No Linux %s Ramdisk Image ## Loading init Ramdisk from multi component Legacy Image at %08lx ... initrd_highramdisk - allocation error Loading Ramdisk to %08lx, end %08lx ... %d Bytes = %4d-%02d-%02d %2d:%02d:%02d UTC Bad magic number Bad header crc Bad data crc Bad image type Empty Script Wrong image format for "source" command loadaddrHunting with: %s %s.%spart_%xwhole%.*s.%s.bootdev%.*s.blkpxedhcpUnknown uclass '%s' in label No bootdevs for '%s' Missing bootstd device ** Booting bootflow '%s' with %s Boot failed (err=%d) bootmethboot_targetsbootstdbootstd_drvbootmeth_u-boot,boot-std/boot/extlinux/extlinux.confbootmeth_extlinuxu-boot,extlinuxERROR: - must RESET the board to recover. ERROR: reserving fdt memory region failed (addr=%llx size=%llx flags=%x) reserved-memoryregno-mapimage is not a fdtfdt_highdevice tree - allocation error Failed using fdt_high value for Device Tree Using Device Tree in place at %p, end %p Loading Device Tree to %p, end %p ... fdt move failed## Flattened Device Tree from Legacy Image at %08lx fdt header checksum invalidfdt checksum invaliduImage is not a fdtuImage is compresseduImage data is not a fdtfdt overwritten## Flattened Device Tree blob at %08lx ERROR: Did not find a cmdline Flattened Device Tree Booting using the fdt blob at %#08lx ## Flattened Device Tree from multi component Image at %08lX Booting using the fdt at 0x%p fdt size != image sizeERROR: root node setup failed ERROR: /chosen node create failed ERROR: arch-specific fdt fixup failed u-boot,bootconf - must RESET the board to recover. ## Starting application at 0x%08lX ... ## Application terminated, rc = 0x%lX resetPerform RESET of the CPU- cold boot without level specifier reset -w - warm reset if implementedgostart application at address 'addr'addr [arg ...] - start application at address 'addr' passing 'arg' as argumentsTrying to execute a command out of order bootcmd ## Checking Image at %08lx ... Legacy image found Bad Magic Number Bad Header Checksum Bad Data CRC Unknown image format! Automatic boot of image at addr 0x%08lX ... iminfoprint header information for application imageaddr [addr ...] - print header information for application image starting at address 'addr' in memory; this includes verification of the image contents (magic number, header and payload checksums)bootdboot default, i.e., run 'bootcmd'boot application image from memoryloadoscmdlinebdtprepfakealias for 'help'helpprint command description/usage - print brief description of all commands help command ... - print detailed usage of 'command'panicPanic with optional message[message]gcc (Debian 12.3.0-5) 12.3.0 GNU ld (GNU Binutils for Debian) 2.40.90.20230705 print monitor, compiler and linker versionERRORinf no %s devices available no %s partition table available ... is now current device %s device %d not available %s read: device %d block # %lu, count %lu ... %ld blocks read: %s write %s write: device %d block # %lu, count %lu ... %ld blocks written: %s Flags not supported: enable CONFIG_BOOTSTD_FULL Out of memory bootflowBoot flowsscan## Executing script at %08lx sourcerun script from memory%-12s= 0x%0*lx %-12s= 0x%.*llx boot_paramsDRAM bank-> start-> sizeflashstartflashsizeflashoffsetbaudrate = %u bps relocaddrreloc offBuild%-12s= %u-bit eth%iaddrethaddrcurrent eth = %s %-12s= (not set) %-12s= %pM IP addr = %s fdt_blobnew_fdtfdt_sizedevicetree = %s bdinfoprint Board Info structurechanged to max of %u entries of %u blocks each hits: %u misses: %u entries: %u max blocks/entry: %u max cache entries: %u blkcacheblock cache diagnostics and controlshow - show and reset statistics blkcache configure - set max blocks per entry and max cache entries showconfigureList of available devices |-- %s (%s%s) | |-- %s coninfoprint console devices and informationunknown Cannot find RTC: err=%d Reset RTC... ## Failed to set date after RTC reset ## Bad date format ## Set date failed: err=%d ## Get date failed Date: %4d-%02d-%02d (%sday) Time: %2d:%02d:%02d get/set/reset date & time[MMDDhhmm[[CC]YY][.ss]] date reset - without arguments: print date & time - with numeric argument: set the system date & time - with 'reset' argument: reset the RTCSunMonTuesWednesThursFriSatur-necho args to console[-n] [args..] - echo args to console; -n suppresses newline## Starting application at 0x%08lx ... ## Application terminated, rc = 0x%lx tftpAutomatic boot of VxWorks image at address 0x%08lx ... ## Ethernet MAC address not copied to NV RAM bootaddr## VxWorks bootline address not specified ## VxWorks boot device not specified bootfilehost:%s host:vxWorks e=%s:%08x h=%s g=%s hostnametn=%s othbootargs## Using bootline (@ 0x%lx): %s ## Not an ELF image, assuming binary ## Starting vxWorks at 0x%08lx ... bootvxBoot vxWorks from an ELF image [address] - load address of vxWorks ELF image.bootelfBoot from an ELF image in memory[-p|-s] [address] - load ELF image at [address] via program headers (-p) or via section headers (-s)exitexit scriptext4loadload binary file from a Ext4 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext4 filesystemext4lslist files in a directory (default /) [directory] - list files from 'dev' on 'interface' in a 'directory'ext4sizedetermine a file's size - Find file 'filename' from 'dev' on 'interface' and determine its size.ext2loadload binary file from a Ext2 filesystem [ [addr [filename [bytes [pos]]]]] - load binary file 'filename' from 'dev' on 'interface' to address 'addr' from ext2 filesystem.ext2lsusage: fatinfo [] ** Unable to use %s %d:%d for fatinfo ** fatinfoprint information about filesystem [] - print information about filesystem from 'dev' on 'interface'fatls [] [directory] - list files from 'dev' on 'interface' in a 'directory'fatloadload binary file from a dos filesystem [ [ [ [bytes [pos]]]]] - Load binary file 'filename' from 'dev' on 'interface' to address 'addr' from dos filesystem. 'pos' gives the file position to start loading from. If 'pos' is omitted, 0 is used. 'pos' requires 'bytes'. 'bytes' gives the size to load. If 'bytes' is 0 or omitted, the load stops on end of file. If either 'pos' or 'bytes' are not aligned to ARCH_DMA_MINALIGN then a misaligned buffer warning will be printed and performance will suffer for the load.fatsizefdt_max_dump", "* 0x%p [0x%08x]<0x%08x%s[%02x%sWorking FDT set to %lx fdtaddrControlWorking/* NULL pointer error */%s fdt: %08lx New length %d < existing length %d, ignoring libfdt fdt_open_into(): %s moNew length 0x%X < existing length 0x%X, aborting. No FDT memory address configured. Please configure the FDT address via "fdt addr
" command. Aborting! mklibfdt fdt_path_offset() returned %s libfdt fdt_add_subnode(): %s prop (%d) doesn't fit in scratchpad! Sorry, I could not convert "%s" Unexpected character '%c' libfdt fdt_setprop(): %s libfdt node not found 0x%08Xerror: unprintable value libfdt fdt_getprop(): %s %s%s { Nested too deep, aborting. %s}; %s%s; %s%s = %s/* NOP */ Unknown tag 0x%08X libfdt fdt_delprop(): %s libfdt fdt_del_node(): %s magic: 0x%x totalsize: 0x%x (%d) off_dt_struct: 0x%x off_dt_strings: 0x%x off_mem_rsvmap: 0x%x version: %d last_comp_version: %d boot_cpuid_phys: 0x%x size_dt_strings: 0x%x size_dt_struct: 0x%x number mem_rsv: 0x%x booindex start size ------------------------------------------------ libfdt fdt_get_mem_rsv(): %s %x %08x%08x %08x%08x libfdt fdt_add_mem_rsv(): %s libfdt fdt_del_mem_rsv(): %s flattened device tree utility commandstotalsizeoff_dt_structoff_dt_stringsoff_mem_rsvmaplast_comp_versionboot_cpuid_physsize_dt_stringssize_dt_structres Reset IDE: Cannot remove IDE (err=%dE) Init failed (err=%dE) diskbootboot from IDE deviceloadAddr dev:partIDE sub-systemreset - reset IDE controller ide info - show available IDE devices ide device [dev] - show or set current device ide part [dev] - print partition table of one or all IDE devices ide read addr blk# cnt ide write addr blk# cnt - read/write `cnt' blocks starting at block `blk#' to/from memory address `addr' Loading from %s device %d, partition %d: Name: %.32s Type: %.32s ** Read error on %d:%d ** Bad Header Checksum ** ** Unknown image type Unknown operator '%s' Invalid data width specifier itestreturn true/false on integer compare[.b, .w, .l, .s] [*]value1 [*]value2-lt-gt-eq==-ne!=<>-ge>=-le<= %s ## Total Size = 0x%08x = %d Bytes Cannot overwrite reserved area (%08lx..%08lx) ## First Load Addr = 0x%08lX ## Last Load Addr = 0x%08lX ## Total Size = 0x%08lX = %ld Bytes loads_echo## Ready for S-Record download ... ## S-Record download aborted ## Start Addr = 0x%08lX ## Switch baudrate to %d bps and press ENTER ... loady## Ready for binary (ymodem) download to 0x%08lX at %d bps... ## Binary (ymodem) download aborted loadx## Ready for binary (xmodem) download to 0x%08lX at %d bps... ## Binary (xmodem) download aborted ## Ready for binary (kermit) download to 0x%08lX at %d bps... ## Binary (kermit) download aborted ## Switch baudrate to %d bps and press ESC ... load binary file over serial line (ymodem mode)[ addr [ baud ] ] - load binary file over serial line at address 'addr' with baudrate 'baud'load binary file over serial line (xmodem mode)loadbload binary file over serial line (kermit mode)loadsload S-Record file over serial line[ off ] - load S-Record file over serial line with offset 'off'Base Address: 0x%08lx crc32The seed cannot be 0. Using 0xDEADBEEF. %lu bytes filled with random data byte%s at 0x%08lx (%#0*lx) != %s at 0x%08lx (%#0*lx) Total of %ld %s(s) were the same %08lx: %08x %0lx %04x %02x ? Zero length ??? halfworddouble wordrandomfill memory with random pattern [] - Fill 'len' bytes of memory starting at 'addr' with random data loopinfinite loop on address range[.b, .w, .l, .q] address number_of_objectsbaseprint or set address offset - print address offset for memory commands base off - set address offset for memory commands to 'off'checksum calculationaddress count [addr] - compute CRC32 checksum [save at addr]cmpmemory compare[.b, .w, .l, .q] addr1 addr2 countmemory copy[.b, .w, .l, .q] source target countmwmemory write (fill)[.b, .w, .l, .q] address value [count]nmmemory modify (constant address)[.b, .w, .l, .q] addressmmmemory modify (auto-incrementing address)memory display[.b, .w, .l, .q] address [# of objects]%2u %2u-%2u = %5u %sFDXHDX100fullhalfIEEE 802.3 CSMA/CDIEEE 802.9 ISLAN-16T???Incorrect PHY address. Range should be 0-31 PHY 0x%02X: OUI = 0x%04X, Model = 0x%02X, Rev = 0x%02X, %3dbase%s, %s Error reading from the PHY addr=%02x reg=%02x addr=%02x reg=%02x data=%04X Error writing to the PHY addr=%02x reg=%02x Error reading from the PHY addr=%02xError writing to the PHYduThe MII dump command only formats the standard MII registers, 0-5, 9-a. %u. (%04hx) -- %s -- (%04hx:%04x) %u.%2u,%2u = b%u%u speed selection = %s Mbps = %sMII utility commandsdevice - list available devices mii device - set current device mii info - display MII PHY info mii read - read MII PHY register mii write - write MII PHY register mii modify - modify MII PHY register updating bits identified in mii dump - pretty-print (0-5 only) Addr and/or reg may be ranges, e.g. 2-7.PHY control registerPHY status registerPHY ID 1 registerPHY ID 2 registerAutonegotiation advertisement registerAutonegotiation partner abilities register1000BASE-T control register1000BASE-T status registermaster/slave config faultmaster/slave config resultlocal receiver status OKremote receiver status OK1000BASE-T full duplex able1000BASE-T half duplex able(reserved)1000BASE-T idle error countertest modemanual master/slave enablemanual master/slave valuemulti/single portautomatic TDR on link downnext page ableacknowledgeremote faultasymmetric pause able100BASE-T4 able100BASE-X full duplex able100BASE-TX able10BASE-T full duplex able10BASE-T ablepartner selectorasymmetric pausepause enable100BASE-TX full duplex able10BASE-T full duplex able10BASE-T ableOUI portionmanufacturer part numbermanufacturer rev. number100BASE-X full duplex able100BASE-X half duplex able10 Mbps full duplex able10 Mbps half duplex able100BASE-T2 full duplex able100BASE-T2 half duplex ableextended statusMF preamble suppressionA/N completeA/N ablelink statusjabber detectextended capabilitiesloopbackspeed selectionA/N enablepower-downisolaterestart A/Ncollision test enablePHY does not have extended functions No MDIO bus found Reading from bus %s PHY at address %x: Error %d.%d - 0x%x mdioMDIO utility commandslist - List MDIO buses mdio read [.] - read PHY's register at . mdio write [.] - write PHY's register at . mdio rx [.] - read PHY's extended register at . mdio wx [.] - write PHY's extended register at . may be: , and may be ranges, e.g. 1-5.4-0x1f. sleepdelay execution for some timeN - delay execution for N seconds (N is _decimal_ and can be fractional)mtdparts support missing. Offset exceeds device limit '%s' is not a number Size exceeds partition or device limit device %d whole chip offset 0x%llx, size 0x%llx activeeth%d : %s %pM %s ping failed; host %s is not alive host %s is alive rootpathdnsipdomainautoloadNET sub-systemlist - list available devices listpingsend ICMP ECHO_REQUEST to network hostpingAddressnfsboot image via network using NFS protocol[loadAddress] [[hostIPaddr:]bootfilename]boot image via network using DHCP/TFTP protocoltftpbootload file via network using TFTP protocolbootpboot image via network using BOOTP/TFTP protocolCannot find SATA device %d (err=%d) Cannot remove SATA device '%s' (err=%d) Cannot probe SATA device %d (err=%d) No SATA device found! Cannot scan SATA device %d (err=%d) stopSATA sub systeminit - init SATA sub system sata stop [dev] - disable SATA sub system or device sata info - show available SATA devices sata device [dev] - show or set current device sata part [dev] - print partition table sata read addr blk# cnt sata write addr blk# cnterasemallocReadWrittenprobeFailed to initialize SPI flash at %u:%u (error %d) No SPI flash selected. Please run `sf probe' updateERROR: attempting %s past flash size (%#x) ERROR: flash area is locked Updating, %zu%% %lu B/sSPI flash failed in %s step %zu bytes written, %zu bytes skipped in %ld.%lds, speed %ld B/s SF: %zu bytes @ %#x %s: ERROR %d SF: %zu bytes @ %#x Erased: protectstart sector is not a valid number len is not a valid number unlocksfSPI flash sub-systemtruedo nothing, successfullyfalsedo nothing, unsuccessfullyminimal test like /bin/sh[args..]-o-a-z-eSee InterfaceCommunicationHuman InterfacePrinterMass StorageHubCDC DataVendor specificAudioHuman Interface, Subclass: NoneBoot KeyboardMousereservedMass Storage, RBC SFF-8020i (ATAPI)QIC-157 (Tape)UFISFF-8070Transp. SCSICommand/BulkCommand/Bulk/IntBulk only%d: %s, USB Revision %x.%x - %s %s %s - Class: - Class: (from Interface) %s - PacketSize: %d Configurations: %d - Vendor: 0x%04x Product 0x%04x Version %d.%d 12 Mb/s+- %s (%s, %dmA) %s %s %s %s String: "%s"Self Powered Bus Powered Remote Wakeup InOut Configuration: %d - Interfaces: %d %s%s%dmA Interface: %d - Alternate Setting %d, Endpoints: %d - Class - - Endpoint %d %s IsochronousInterrupt MaxPacket %d Interval %dmsstarting USB... resetting USB... stopping USB.. USB is stopped. Please issue 'usb start' first. USB device tree: config for device %d *** No device available *** Device %d does not exist. Device is no hub or does not have %d ports. Setting Test_J modeSetting Test_K modeSetting Test_SE0_NAK modeSetting Test_Packet modeSetting Test_Force_Enable modeUnrecognized test mode: %s Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] on downstream facing port %d... on upstream facing port... Error during SET_FEATURE. Test mode successfully set. Use 'usb start' to return to normal operation. stor1.5 Mb/s480 Mb/s5 Gb/susbbootboot from USB deviceUSB sub-systemstart - start (scan) USB controller usb reset - reset (rescan) USB controller usb stop [f] - stop USB [f]=force stop usb tree - show USB device tree usb info [dev] - show available USB devices usb test [dev] [port] [mode] - set USB 2.0 test mode (specify port 0 to indicate the device's upstream port) Available modes: J, K, S[E0_NAK], P[acket], F[orce_Enable] usb storage - show details of USB storage devices usb dev [dev] - show or set current USB storage device usb part [dev] - print partition table of one or all USB storage devices usb read addr blk# cnt - read `cnt' blocks starting at block `blk#' to memory address `addr' usb write addr blk# cnt - write `cnt' blocks starting at block `blk#' from memory address `addr'## Copying part %d from legacy image at %08lx ... Must specify load address for %s command with compressed image Bad Image Part Invalid image type for imxtract Loading part %d ... Uncompressing part %d ... GUNZIP ERROR - image not loaded fileaddrimxtractextract a part of a multi-image%s=%s ## Error: cannot export environment Environment size: %d/%ld bytes ## Error: "%s" not defined ## Warning: defaulting to text format ## Error: external checksum format must pass size ## Warning: Input data exceeds %d bytes - truncated ## Info: input data size = %zu = 0x%zX ## Error: Invalid size 0x%zX ## Error: bad CRC, import failed ## Error: Environment import failed: errno = %d ## %s: only one of "-b", "-c" or "-t" allowed ## Resetting to default environment ## Error: illegal character '='in variable name "%s" ## Can't malloc %d bytes ## Error inserting "%s" variable, errno=%d edit: setenv## Error: Cannot export environment: errno = %d %zX## Error: %s: only one of "-b", "-c" or "-t" allowed runrun commands in an environment variablevar [...] - run the commands in the environment variable(s) 'var'set environment variablessetenv [-f] name value ... - [forcibly] set environment variable 'name' to 'value ...' setenv [-f] name - [forcibly] delete environment variable 'name'printenvprint environment variables[-a] - print [all] values of all environment variables printenv name ... - print value of environment variable 'name'editenvedit environment variablename - edit environment variable 'name'environment handling commandsdeleteeditexportimportprintsaveexistssaveenvsave environment variables to persistent storageprebootNo CLI availablesyntax error ERROR : xmalloc failed ERROR : xrealloc failed ** Abort => *?[\%u%s: readonly variable%s=%sHUSH_NO_EVALUnknown command '%s' - try 'help' or use 'run' command IFS\$'";&|#;$&|exit not allowed from main input shell. HUSH_VERSION0.01showvarprint local hushshell variables - print values of all hushshell variables showvar name ... - print value of hushshell variable 'name'thenelifelseforwhileuntildodonebootdelaykernel-offsetkernaddrrootdisk-offsetrootaddrHit any key to stop autoboot: %2d  0%2d DRAM: baudrate (effective initcall sequence %p failed at call %p (err=%d) Net: load-environmentCore: %d devices, %d uclasses, devicetree: %sWarning: Device tree includes old 'u-boot,dm-' tags: please fix by 2023.07! #size-cells%s: Bad cell count for %s %s: %s: %s fdt_root: %s serial#serial-numberWARNING: could not set serial-number %s. fdt_initrd: %s linux,initrd-startlinux,initrd-endWARNING: could not set linux,initrd-start %s. WARNING: could not set linux,initrd-end %s. fdt_chosen: %s WARNING: could not set bootargs %s. 2023.07+dfsg-1u-boot,versionWARNING: could not set u-boot,version %s. Unable to update property %s:%s, err=%s %s: num banks %d exceeds hardcoded limit %d. Recompile with higher MEMORY_BANKS_MAX? device_typeWARNING: could not set %s %s. /aliasesetherneteth%daddrlocal-mac-addressrangesThe address of the fdt is invalid (NULL). libfdt fdt_check_header(): %s - too old, fdt %d < %d - too new, fdt %d > %dNULL device name! mdio_register: non unique device name '%s' %s: %x - %s <--> %s No such device: %s %s is not a known ethernet MII devices: '%s' Current device: '%s' PHY speedPHY AN speedPHY AN adv speed read failed, assuming 10BASE-T PHY duplexPHY AN duplexPHY AN adv duplex read failed, assuming half duplex unable to get device descriptor (error=%d) USB device descriptor short read (expected %i, got %i) %s: invalid max packet size unable to get descriptor, error %lX config descriptor too short (expected %i, got %i) selecting invalid interface %dusb_new_device: Cannot read configuration, skipping device %04x:%04x ERROR: NOT USB_CONFIG_DESC %x ERROR: Invalid USB CFG length (%d) ERROR: Invalid USB IF length (%d) USB IF descriptor overflowed buffer! Too many USB interfaces! ERROR: Invalid USB EP length (%d) USB EP descriptor overflowed buffer! Endpoint descriptor out of order! Interface %d has too many endpoints! ERROR: Invalid USB EPC length (%d) USB EPC descriptor overflowed buffer! EPC descriptor out of order! failed to set default configuration len %d, status %lX Cannot allocate device context to get SLOT_ID USB device not accepting new address (error=%lX) Error: Cannot find high speed parent of usb-1 device cannot reset port %i!? usb_pgood_delayCan't allocate memory for USB device! Port %d over-current occurred %d times usb_hubusb-hub Did not get interrupt on CBI cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X (NOT READY) cmd 0x%02X returned 0x%02X 0x%02X 0x%02X 0x%02X Device %d: No storage devices, perhaps not 'usb start'ed..? scanning usb for storage devices... %d Storage Device(s) found USB Storage Transport unknown / not yet implemented Sorry, protocol %d not yet supported. Device NOT ready Request Sense returned %02X %02X %02X READ_CAP ERROR error in inquiry lun%dusb_storage_blkusb_bootdevusb_mass_storageusb-mass-storageEnter choice: %s not found %.*s%*s stdinstdoutstderrIn: No input devices available! Out: No output devices available! Err: No error devices available! pre-reloc realloc() is not supportedalloc space exhausted CRC32 for %08lx ... %08lx ==> %08lx bootsecure## Error: Secure boot command not specified ## Error: "%s" returned (code %d) %s - %s Usage: %s - No additional help available. %-*s- %s Unknown command '%s' - try 'help' without arguments for list of all known commands xtrace+Unknown command '%s' - try 'help' 'bootd' recursion detected loadxy_timeoutUnknown errorBlock sequence errorCRC/checksum errorInvalid framingCancelledEnd of fileTimed outSorry, zModem not available yetCan't access file(%d:%d) Vendor: %s Prod.: %s Rev: %s Model: %s Firm: %s Ser#: %s Vendor: %s Rev: %s Prod: %s %s VirtIO Block Device EFI media Block Device %d device type unknown Unhandled device type: %i Type: Removable Hard DiskCD ROMOptical DeviceTape# %02X # Supports 48-bit addressing Capacity: %lu.%lu MB = %lu.%lu GB (%lu x %lu) Capacity: not available ## Unknown partition table type %x Partition Map for IDESATAUSBMMCHOSTNVMePV BLOCKVirtIOEFIUNKNOWN device %d -- Partition Type: %s Whole Disk** Bad device specification %s %s ** ** Bad HW partition specification %s %s ** bootdevice** No device specified ** auto** Bad partition specification %s %s ** ** Bad device size - %s %s ** ** No partition table - %s %s ** ** Invalid partition %d ** ** No valid partitions found ** ** Invalid partition type "%.32s" (expect "U-Boot") Could not find "%s" partition Couldn't find partition %s %s hdusbdmmcsdxx%s%c%d%s:%dblk_partitionFATFAT32** Nested DOS partitions detected, stopping ** ** Can't read partition table on %d:%lu ** bad MBR sector signature 0x%02x%02x Boot Extd%3d %-10lu %-10lu %08x-%02x %02x%s%s Part Start Sector Num Sectors UUID Type DOS** First descriptor is NOT a primary desc on %d:%d ** CD001** Wrong ISO Ident: %s on %d:%d ** EL TORITO SPECIFICATION** No valid boot catalog found on %d:%d ** ** Wrong El Torito ident: %s on %d:%d ** ** Can't read Boot Entry at %lX on %d:%d ** ** Checksum Error in booting catalog validation entry on %d:%d ** ** Key 0x55 0xAA error on %d:%d ** ** Partition %d not found on device %d ** ** Partition %d is not bootable on device %d ** ** No boot partition found on device %d ** Part Start Sect x Size Type %2d %8lu %8lu %6ld %.32s ISO(none) IDE device %d: Device %d: unknown device scsinvmenvmxipefiloadervirtiopvblockblkmapIDE read: device %d not ready Error (no IRQ) dev %d blk %lx: status %#02x Bus %d: ** Timeout ** not available OK blk#%dide_blkide_bootdevNo Powersaving mode %x u-boot,bootdev-ide%s: null device unbind() method failed on dev '%s' on error path Failed to unbind dev '%s' on error path %s: Device '%s' failed to remove on error path No match for driver '%s' compatibleDevice tree error at node '%s' Error binding driver '%s': %d Some drivers failed to bind Virtual root driver does not exist! Virtual root driver already exists! Some drivers were not found /clocks/firmwarerootroot_drivernopdevice '%s' failed to unbind %s: Device '%s' failed to remove, but children are gone %s: Device '%s' failed child_post_remove()simple_bussimple-bussimple-mfdbootph-allbootph-some-rambootph-pre-rambootph-pre-sramu-boot,dm-pre-relocu-boot,dm-pre-properu-boot,dm-splu-boot,dm-tplu-boot,dm-vpl/configphy-modephy-connection-typephy-handlephy-deviceinternalrev-miirev-rmiirgmii-idrgmii-rxidrgmii-txidrtbismiixlgmiimocaqsgmiitrgmii100base-x1000base-x2500base-xrxaui10gbase-r25gbase-rusxgmii10gbase-krqusgmii1000base-kxspi_flash@%d:%djedec_spi_norspi_flashSF: Failed to set up slave jedec,spi-normx25l2005amx25l4005amx25l8005mx25l1606emx25l3205dmx25l6405dmx25u2033emx25u1635emx25u3235fmx25u6435fmx25l12805dmx25u12835fmx25u51245gmx25l12855emx25l25635emx25u25635fmx25v8035fmx25r1635fmx25l25655emx66l51235lmx66u51235fmx25u51245fmx66u1g45gmx66u2g45gmx66l1g45gmx66l2g45gmx25l1633emx25r6435fmx66uw2g345gx0mx66lm1g45gmx25lm51245gmx25lw51245gmx25lm25645gmx66uw2g345gmx66um1g45gmx66uw1g45gmx25uw51245gmx25uw51345gmx25um25645gmx25uw25645gmx25um25345gmx25uw25345gmx25uw12845gmx25uw12345gmx25uw6445gmx25uw6345g%s %s: Erase operation failed. udevice *)(NULL%s %s: Program operation failed. %s %s: Attempted to modify a protected sector. %s %s: flash operation timed out %s %s: Failed to enable octal DTR mode %s %s: Macronix Quad bit not set %s %s: unrecognized JEDEC id bytes: %02x, %02x, %02x m25p,fast-read%s%dSF: Detected %s with page size , erase size , total Err..(%s) Dropping packet spread on multiple descriptors Err..(%s) Dropping packet with errors Non-aligned data too large (%d) Err..(%s) in xmit packet marvell,kirkwood-eth-portfixed-linkfull-duplexFailed to allocate MDIO bus Error: SMI busy timeout Err..(%s) Invalid PHY address %d Err..(%s) Invalid register offset %d Err..(%s) SMI read ready timeout Err..(%s) Invalid phy address Err..(%s) Invalid register offset phy_connect failed mvgbemarvell,kirkwood-ethncipncoutportncinportnc(null bus)Failed to allocate PHY device for %s:%d %s, PHY probe failed %s Waiting for PHY auto negotiation to complete TIMEOUT ! user interrupt! done PHY reset timed out %s:%d is connected to %s. Reconnecting to %s Could not get PHY for %s: addr %d Generic PHYWaiting for PHY realtime linkmarvell,reg-initMarvell 88E1680Marvell 88E1310Marvell 88E151xMarvell 88E1240Marvell 88E1149SMarvell 88E1145Marvell 88E1121RMarvell 88E1118RMarvell 88E1118Marvell 88E1111SMarvell 88E1011Sstdout-pathNo serial driver found## Baudrate %d bps not supported ## Baudrate may not be deleted reg-offsetreg-shiftreg-io-widthclock-frequencyns16550_serialns16550ns16550aingenic,jz4780-uartnvidia,tegra20-uartsnps,dw-apb-uart%s %s: Cannot set speed (err=%d) %s %s: Cannot set mode (err=%d) spi-max-frequency%s %s: Invalid cs %d (err=%d) Invalid bus %d (err=%d) %s %s: Invalid chip select %d:%d (err=%d) spi-cpolspi-cphaspi-cs-highspi-3wirespi-half-duplexspi-tx-bus-widthspi-tx-bus-width %d not supported spi-rx-bus-widthspi-rx-bus-width %d not supported spi_generic_drvspi_generic*** spi_xfer: Time out during SPI transfer mvebu_spimarvell,orion-spimarvell,armada-375-spimarvell,armada-380-spimarvell,armada-xp-spitick-timerorion_timermarvell,orion-timermarvell,armada-370-timermarvell,armada-xp-timersata_blknr-portssata_mv_blkUnable to allocate memory for request queue Unable to allocate memory for response queue SATA%dFailed to malloc id data Err: Failed to identify SATA device %d Device error on port: %d Device not ready on port: %d We only support <64K transfers for now Failed to wait for completion on port %d ATA operation timed out sata_mv_ahcimarvell,armada-370-satamarvell,orion-sataError: RTC did not increment. Warning: Only century %d supported. Error: RTC in 12 hour mode, can't determine AM/PM. rtc-mvmarvell,kirkwood-rtcmarvell,orion-rtcusb,device-classusb,interface-classgeneric_bus_%x_dev_%xusb_dev_generic_drvscanning bus %s for devices... No USB Device found %d USB Device(s) found Bus %s: Port not available. probe failed, error %d No working controllers found usb_dev_genericu-boot,bootdev-usbEHCI fail timeout STS_ASS reset out of buffer pointers (%zu bytes left) EHCI failed: timeout when disabling periodic list EHCI failed: timeout when enabling periodic list EHCI failed to shut down host controller. Timeout destroying interrupt endpoint queue %s: xfers requiring several transactions are not supported. Timeout poll on interrupt endpoint unable to allocate TDs unable to construct SETUP TD unable to construct DATA TD EHCI fail timeout STS_ASS set EHCI fail timeout STS_IAA set EHCI timed out on TD - token=%#x port(%d) reset error EHCI fail to reset USB EHCI %x.%02x marvell,armada-3700-ehcimarvell,ac5-ehciehci_mvebumarvell,orion-ehcienv_buf [%u bytes] too small for value of "%s" %pMmissing environment variable: %s autostart*** Warning - %s, using default environment bad CRCCannot import environment: errno = %d import failed${...}${Loading Environment from %s... not initialized Failed (%d) Saving Environment to %s... not possible ^%s$Error compiling regex: %s eth\d*addr:ma,ipaddr:i,gatewayip:i,netmask:i,serverip:i,nvlan:d,vlan:d,dnsip:i,## Warning: Unknown environment variable type '%c' ## Warning: Unknown environment variable access method '%c' .flags## Error: flags type check failure for "%s" <= "%s" (type: %c) ## Error: Can't delete "%s" ## Error: Can't overwrite "%s" oldval: %s defval: %s ## Error: Can't create "%s" \.callbacks:callbacks,\.flags:flags,baudrate:baudrate,bootfile:bootfile,ipaddr:ipaddr,gatewayip:gatewayip,netmask:netmask,serverip:serverip,nvlan:nvlan,vlan:vlan,eth\d*addr:ethaddr,bootmeths:bootmeths,loadaddr:loadaddr,stdin:console,stdout:console,stderr:console,serial#:serialno,.callbacksspi_flash_probe_bus_cs() failedErasing SPI flash...Writing to SPI flash...malloc() failedspi_flash_read() failedSPIFlash** Reading file would overwrite reserved memory ** %s/ %s %8lld %s %d file(s), %d dir(s) Can't set block device ** No boot file defined ** Failed to load '%s' %llu bytes read in %lu ms (fatext4unsupported** Can not find directory. ** ** File not found %s ** invalid extent block ** SI ext2fs read block (indir 1)malloc failed. ** ** SI ext2fs read block (indir 1):malloc failed. ** ** SI ext2fs read block (indir 1)failed. ** ** DI ext2fs read block (indir 2 1)malloc failed. ** ** DI ext2fs read block (indir 2 1)failed. ** ** DI ext2fs read block (indir 2 2)malloc failed. ** ** DI ext2fs read block (indir 2 2)failed. ** ** TI ext2fs read block (indir 2 1)malloc failed. ** ** TI ext2fs read block (indir 2 1)failed. ** ** TI ext2fs read block (indir 2 2)malloc failed. ** ** TI ext2fs read block (indir 2 2)failed. ** Failed to iterate over directory %s < ? > %10u %s Error: Invalid FAT entry: 0x%08x FAT32 FAT12 FAT16 Error: FAT sector size mismatch (fs=%hu, dev=%lu) Error: FAT cluster size not set Error: FAT cluster size too big (cs=%u, max=%u) UNo current device Interface: %s No valid FAT fs found Filesystem: %s "%s" Invalid FAT entry Error reading cluster %02X%02X-%02X%02X** Invalid Block Device Descriptor (NULL) ** %s read error ** ** %s read error - block * %s read error - last part invalid distance too far backinvalid distance codeinvalid literal/length codeunknown compression methodincorrect header checkunknown header flags setinvalid window sizeheader crc mismatchinvalid block typeinvalid stored block lengthstoo many length or distance symbolsinvalid code lengths setinvalid bit length repeatinvalid literal/lengths setinvalid distances setincorrect data checkincorrect length checkError: Bad gzipped data Error: gunzip out of data in header 1.2.3Error: inflateInit2() returned %d Error: inflate() returned %d linux,phandleFDT_ERR_NOTFOUNDFDT_ERR_EXISTSFDT_ERR_NOSPACEFDT_ERR_BADOFFSETFDT_ERR_BADPATHFDT_ERR_BADPHANDLEFDT_ERR_BADSTATEFDT_ERR_TRUNCATEDFDT_ERR_BADMAGICFDT_ERR_BADVERSIONFDT_ERR_BADSTRUCTUREFDT_ERR_BADLAYOUTFDT_ERR_INTERNALFDT_ERR_BADNCELLSFDT_ERR_BADVALUEFDT_ERR_BADOVERLAYFDT_ERR_NOPHANDLESFDT_ERR_BADFLAGS#address-cellsNo valid device tree binary found at %p okayseparatefitembednvidia,tegra20-emcnvidia,tegra20-emc-tablenvidia,tegra20-nandnvidia,tegra124-xusb-padctlnvidia,tegra210-xusb-padctlsamsung,exynos-usb-physamsung,exynos5250-usb3-physamsung,exynos-tmusamsung,exynos-mipi-dsisamsung,exynos-dwmmcsamsung,sysmmu-v3.3intel,microcodeintel,quark-mrcaltr,socfpga-stmmacaltr,socfpga-dw-mshcsnps,dwc2intel,baytrail-fspintel,baytrail-fsp-mdpintel,ivybridge-fspaltr,clk-mgrpinctrl-singlealtr,socfpga-hps2fpga-bridgealtr,socfpga-lwhps2fpga-bridgealtr,socfpga-fpga2hps-bridgealtr,socfpga-fpga2sdram0-bridgealtr,socfpga-fpga2sdram1-bridgealtr,socfpga-fpga2sdram2-bridgealtr,socfpga-a10-fpga-mgraltr,socfpga-a10-nocaltr,socfpga-a10-clk-init## ERROR: unsupported match method: 0x%02x Env export buffer too small: %lu, but need %lu himport_r: can't insert "%s=%s" into hash table WARNING: '%s' neither in running nor in imported env! WARNING: '%s' not in imported env, deleting it! , Build: %s%llu Hz%s%lu.%ld %cHz%s%u Bytes%s %ciB%s %0*lx### ERROR ### Please RESET the board ### %s.cnt = 0x%lx / max = 0x%lx %s[%d] [0x%llx-0x%llx], 0x%08llx bytes flags: %x lmb_dump_all: ERROR: Failed to allocate 0x%lx bytes below 0x%lx. RE is too long (code overflow)RE is too long (data overflow)unknown cmd (%d) at %d Jump offset is too bigNo closing ']' bracketNo closing bracketUnbalanced brackets|.^$*+?()[\Could not initialize timer (err %d) Could not read count from timer (err %d) ## No elf image at address 0x%08lx ## Not a 32-bit elf image at address 0x%08lx ## Warning: gatewayip needed but not set ARP Retry count exceeded; starting again bad length %d < %d U-Boot.armbootp_archbootp_vciHost Name*** WARNING: %s is too long (%d - max: %d) - truncated Root Path*** Unhandled DHCP Option in OFFER/ACK: %d DHCP client bound to address %pI4 (%lu ms) DHCP: INVALID STATE bootpretryperiodBOOTP broadcast %d Retry time exceeded; starting again Error: eth device name "%s" has a space! eth_bootdev Error: %s address %pM illegal value Warning: %s failed to set MAC address DT Warning: %s MAC addresses don't match: Address in %s is %pM Address in environment is %pM Warning: %s (eth%d) using random MAC address - %pM ethactethrotatenoethprimeeth%d: %s [PRIME]%s.%du-boot,bootdev-eth%s%daddr%saddreth%dmacskipethmacskipunknownnetretryyesonce ICMP Host Redirect to %pI4 *** ERROR: ping address not given *** ERROR: `serverip' not set *** ERROR: `ipaddr' not set *** ERROR: No ethernet found. *** ERROR: `ethaddr' not set *** ERROR: `eth%daddr' not set NFSCannot autoload with NFS Cannot autoload with TFTPGET Abort Bytes transferred = %d (%x hex) %d.%d.%d.%dnvlan*** ERROR: NFS version not supported *** ERROR: Cannot mount done *** ERROR: File lookup fail *** ERROR: Symlink fail Retry count exceeded; starting again T /nfsroot/%02X%02X%02X%02X.img*** Warning: no boot file name; using '%s' Using %s device File transfer via NFS from server %pI4; our IP address is %pI4; sending through gateway %pI4 Filename '%s/%s'. Size is 0x%x Bytes = Load address: 0x%lx Loading: *octetblksize%c%d%cwindowsize%c%d%cFile too largeFile has bad magicOption Negotiation FailedblksizeInvalid blk size(=%d) Invalid timeout val(=%d s) TFTP error: First block is not block 1 (%ld) Starting again trying to overwrite reserved memory... TFTP error: '%s' (%d) Not retrying... Retry count exceeded %s; starting again tftpblocksizetftpwindowsizetftptimeoutTFTP timeout (%ld ms) too low, set min = 1000 ms tftptimeoutcountmaxTFTP timeout count max (%d ms) negative, set to 0 Capping tftp block size option to %d (was %d) fromTFTP %s server %pI4; our IP address is %pI4Filename '%s'.Load address: 0x%lx bootcmd=setenv ethact ethernet-controller@72000; ${x_bootcmd_ethernet}; setenv ethact ethernet-controller@76000; ${x_bootcmd_ethernet}; ${x_bootcmd_usb}; ${x_bootcmd_kernel}; setenv bootargs ${x_bootargs} ${x_bootargs_root}; bootm 0x6400000;bootdelay=3baudrate=115200loadaddr=0x800000mtdids=mtdparts=x_bootcmd_ethernet=ping 192.168.2.1x_bootcmd_usb=usb startx_bootcmd_kernel=fatload usb 0 0x6400000 uImagex_bootargs=console=ttyS0,115200x_bootargs_root=root=/dev/sda2 rootdelay=100123456789ABCDEFarocsdxbim 0123456789abcdefprobe [[bus:]cs] [hz] [mode] - init flash device on given SPI bus and chip select sf read addr offset|partition len - read `len' bytes starting at `offset' or from start of mtd `partition'to memory at `addr' sf write addr offset|partition len - write `len' bytes from memory at `addr' to flash at `offset' or to start of mtd `partition' sf erase offset|partition [+]len - erase `len' bytes from `offset' or from start of mtd `partition' `+len' round up `len' to block size sf update addr offset|partition len - erase and write `len' bytes from memory at `addr' to flash at `offset' or to start of mtd `partition' sf protect lock/unlock sector len - protect/unprotect 'len' bytes starting at address 'sector'EPTGMK !R\248>Ž ;] - Run script starting at addr/dtaLx`wdwd/dtaw`wdwd /addr [-c] [-q] [] - Set the [control] fdt location to fdt move - Copy the fdt to and make it active fdt resize [] - Resize fdt to size + padding to 4k addr + some optional if needed fdt print [] - Recursive print starting at fdt list [] - Print one level starting at fdt get value [] - Get and store in In case of stringlist property, use optional to select string within the stringlist. Default is 0. fdt get name - Get name of node and store in fdt get addr - Get start address of and store in fdt get size [] - Get size of [] or num nodes and store in fdt set [] - Set [to ] fdt mknode - Create a new node after fdt rm [] - Delete the node or fdt header [get ] - Display header info get - get header member and store it in fdt bootcpu - Set boot cpuid fdt memory - Add/Update memory node fdt rsvmem print - Show current mem reserves fdt rsvmem add - Add a mem reserve fdt rsvmem delete - Delete a mem reserves fdt chosen [ ] - Add/update the /chosen branch in the tree / - initrd start addr/size NOTE: Dereference aliases by omitting the leading '/', e.g. fdt print ethernet0.@Ydta|`wdwdaddr part [dest] - extract from legacy image at and copy to default [-f] -a - [forcibly] reset default environment env default [-f] var [...] - [forcibly] reset variable(s) to their default values env delete [-f] var [...] - [forcibly] delete variable(s) env edit name - edit environment variable env exists name - tests for existence of variable env export [-t | -b | -c] [-s size] addr [var ...] - export environment env import [-d] [-t [-r] | -b | -c] addr [size] [var ...] - import environment env print [-a | name ...] - print environment env run var [...] - run commands in an environment variable env save - save environment env set [-f] name [arg ...] dta `wdwd"nd ta`wdwd)ndta`wdwd.ndta@`wdwd5ndta``wdwdIdta`EIdeId$'dta`*'dC'dkd TaakdldВaߗdTa`[d[dNndta\`Vndwdukd ta`YldsldВa^dTa`^ddod Ta`odod.XdTa`4XdRXd5-dtat`<-ddCd Ta`_d*_dZdTa$`ZdUZd^d Ta`^ddTa8`ddddddTa`ddnAd+dTap`+dwddPc"dc0b`4d"dhc^` _`^`01dxcbDb@d dctcdbd9ha'ddc/dtc8aceJdmd@laпaaXddd.b,b%bd` A=b04b%bd A6b04b%bܒdAb04b%b2b\2bYdA8b,b%bǗd0 "dxa|!dJ`R` "d"datd(cc0c̘cbd9 dI dP`dddadgBbAbdha dlaKbRbJb fdnXdma`D@`H@`\@``@`t@`x@``A`dA`hA`lA`pA`A`A`C`C`C`C`C`C`C`C`C`C`C`C`,D`PD`D`D`D` E`G`G`G`G`G`G`G`G`G`G`H`H`H`H`pI`tI`I`J`J`J`J`J`J`J`K`L`N`N`N`N`O`O`O`c>cDCc8DcFcFcFcJcJcJcJcKcKcKcKcKc LcMcMcMcMcMc$Oc(Oc,Oc0OcQcRc0RcRcUcUcDVcHVcLVc XcdYc\c]cT]cX]c\]c`]cd]ch]cl]c^c ^c$^c(^c,^c0^c4^c8^c<^c@^cD^cH^cL^cP^cT^cX^c\^cacaccccc dc$dc(dc,dc0dc4dc8dc